Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.73
PubTator Score 11.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.7e-20
ependymoma 4679 2.4e-02
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 3.66 1.8
Celiac disease 116 0.0 3.0

Gene RIF (5)

AA Sequence

MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKY      1 - 70
KIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSS     71 - 140
LEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIR    141 - 210
PPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK            211 - 272
//

Text Mined References (19)

PMID Year Title