Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
posterior fossa group B ependymoma 1,530

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 0.000

AA Sequence

MDRGRPAGSPLSASAEPAPLAAAIRDSRPGRTGPGPAGPGGGSRSGSGRPAAANAARERSRVQTLRHAFL      1 - 70
ELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDAEAPADAGLGALRGDGYLHPVKKWPMRSRLYI     71 - 140
GATGQFLKHSVSGEKTNHDNTPTDSQP                                               141 - 167
//

Text Mined References (2)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.