Property Summary

NCBI Gene PubMed Count 17
Grant Count 29
R01 Count 18
Funding $2,883,091.22
PubMed Score 73.14
PubTator Score 51.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.272 0.010
group 3 medulloblastoma 1.200 0.019
lung carcinoma 3.500 0.000
ductal carcinoma in situ -1.200 0.003

Gene RIF (13)

PMID Text
24471494 Cultured astroctye line 1321N1 and primary human astrocytes transport monoamines predominantly through PMAT.
22562044 Transport kinetic analysis revealed that I89M mutant in PMAT protein had a 2.7-fold reduction in maximal transport velocity with no significant change in apparent binding affinity.
21822668 Data show that ENT1, ENT2, ENT4 and CNT3 protein was detected on ovarian carcinoma cells in all effusions, with expression observed in 1-95% of tumor cells.
20858707 The selectivity and kinetics of monoamine neurotransmitter transport by PMAT and OCT3 was determined. PMAT is expressed at much higher levels than hOCT3 in brain, whereas hOCT3 is selectively and highly expressed in adrenal gland and skeletal muscle.
20392501 Observational study of gene-disease association. (HuGE Navigator)
19357181 The data suggest that PMAT is specifically expressed in podocytes and may play an important role in puromycin aminonucleoside-induced kidney injury.
18523561 identification of ENT4 as a highly expressed transcript in desmoplastic small round cell tumor (DSRCT) may represent an attractive pathway for targeting chemotherapeutic drugs into DSRCT
17393420 PMAT, EMT, and OCT2 transporters are expressed in the endometrial stroma and can potentially regulate reuptake of monoamines in general and histamine in particular.
17121826 Amino acid substitution at several sites results in loss of activity ane conformation.
17018840 our data suggest that PMAT is expressed on the apical membranes of renal epithelial cells and may use luminal proton gradient to drive organic cation reabsorption in the kidney.
More...

AA Sequence

MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDEPVPDDRYHAI      1 - 70
YFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGY     71 - 140
LLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAG    141 - 210
VMISLSRILTKLLLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYG    211 - 280
YRVHHDVVAGDVHFEHPAPALAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVA    281 - 350
RVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLAC    351 - 420
SCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVS    421 - 490
YMSGLTLGSAVAYCTYSLTRDAHGSCLHASTANGSILAGL                                  491 - 530
//

Text Mined References (19)

PMID Year Title
24471494 2014 Predominant role of plasma membrane monoamine transporters in monoamine transport in 1321N1, a human astrocytoma-derived cell line.
22562044 2012 Residue Ile89 in human plasma membrane monoamine transporter influences its organic cation transport activity and sensitivity to inhibition by dilazep.
21822668 2012 Nucleoside transporters are widely expressed in ovarian carcinoma effusions.
20858707 2010 Selective transport of monoamine neurotransmitters by human plasma membrane monoamine transporter and organic cation transporter 3.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
19357181 2009 Podocyte-specific expression of organic cation transporter PMAT: implication in puromycin aminonucleoside nephrotoxicity.
18523561 2008 Adenosine transporter ENT4 is a direct target of EWS/WT1 translocation product and is highly expressed in desmoplastic small round cell tumor.
17393420 2007 The organic cation transporters (OCT1, OCT2, EMT) and the plasma membrane monoamine transporter (PMAT) show differential distribution and cyclic expression pattern in human endometrium and early pregnancy decidua.
17121826 2007 Molecular determinants of substrate selectivity of a novel organic cation transporter (PMAT) in the SLC29 family.
17018840 2007 Membrane localization and pH-dependent transport of a newly cloned organic cation transporter (PMAT) in kidney cells.
More...