Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MNGDDAFARRPRAGAQIPEKIQKSFDDIAKYFSKKEWEKMKSLEKISYVYMKRKYEAMTKLGFKATLPPF      1 - 70
MHNTGATDLQGNDFDNDRNQGNQVERPQMTFCRLQRIFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLC     71 - 140
PPGKPSTSEKINKTSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
12216073 2002 The SSX gene family: characterization of 9 complete genes.
11179834 2001 Expressions of cancer-testis antigens in human hepatocellular carcinomas.