Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $38,653.5
PubMed Score 159.71
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.234 0.000
ovarian cancer -1.200 0.000
psoriasis -1.400 0.000

Synonym

Accession Q7RTS7 B5MD61 Q86Y45
Symbols ADWH
HTSS2
HYPT3
KRT5C
K6IRS4
KRT6IRS4

Gene

 Grant Application (1)

Gene RIF (7)

PMID Text
24714551 These observations show for the first time that homozygosity for a KRT74 missense variant may be associated with autosomal recessive pure hair and nail ectodermal dysplasia.
21188418 Data provide evidence implicating that the KRT74 gene in the pathogenesis of autosomal dominant hair loss disorders.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346438 Single Nucleotide Polymorphisms in KRT74 gene is associated with woolly hair.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
12648212 report on the cloning of two novel human type II keratin cDNAs, K6irs3 and K6irs4, which were specifically expressed in the inner root sheath of the hair follicle

AA Sequence

MSRQLNIKSSGDKGNFSVHSAVVPRKAVGSLASYCAAGRGAGAGFGSRSLYSLGGNRRISFNVAGGGVRA      1 - 70
GGYGFRPGSGYGGGRASGFAGSMFGSVALGPACLSVCPPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQE     71 - 140
REQIKVLNDKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKKNLEPILEGYISNLRKQLETLSGDRV    141 - 210
RLDSELRSMRDLVEDYKKRYEVEINRRTTAENEFVVLKKDADAAYAVKVELQAKVDSLDKEIKFLKCLYD    211 - 280
AEIAQIQTHASETSVILSMDNNRDLDLDSIIAEVRMHYEEIALKSKAEAEALYQTKIQELQLAASRHGDD    281 - 350
LKHTRSEMVELNRLIQRIRCEIGNVKKQRASLETAIADAEQRGDNALKDAQAKLDELEGALHQAKEELAR    351 - 420
MLREYQELMSLKLALDMEIATYRKLLEGEECRMSGENPSSVSISVISSSSYSYHHPSSAGVDLGASAVAG    421 - 490
SSGSTQSGQTKTTEARGGDLKDTQGKSTPASIPARKATR                                   491 - 529
//

Text Mined References (13)

PMID Year Title
24714551 2014 Autosomal recessive transmission of a rare KRT74 variant causes hair and nail ectodermal dysplasia: allelism with dominant woolly hair/hypotrichosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21188418 2011 Novel mutations in the keratin-74 (KRT74) gene underlie autosomal dominant woolly hair/hypotrichosis in Pakistani families.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346438 2010 Autosomal-dominant woolly hair resulting from disruption of keratin 74 (KRT74), a potential determinant of human hair texture.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
16874310 2006 K25 (K25irs1), K26 (K25irs2), K27 (K25irs3), and K28 (K25irs4) represent the type I inner root sheath keratins of the human hair follicle.
16831889 2006 New consensus nomenclature for mammalian keratins.
More...