Property Summary

NCBI Gene PubMed Count 25
PubMed Score 401.39
PubTator Score 41.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

AA Sequence

MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLL      1 - 70
QPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRG     71 - 140
LSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIG    141 - 210
YINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHS    211 - 280
LSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS                          281 - 328
//

Text Mined References (25)

PMID Year Title