Property Summary

NCBI Gene PubMed Count 23
Grant Count 126
R01 Count 70
Funding $15,415,977.32
PubMed Score 377.51
PubTator Score 41.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7RTS3 Q9HC25
Symbols PACA
PAGEN2
bHLHa29
PTF1-p48

Gene

Gene RIF (13)

PMID Text
26937009 The results of this study suggested Ptf1a-dependent cell-fate misspecification as a novel mechanism of human brainstem pathology.
26184423 PTF1A enhancer mutations have been shown to cause neonatal diabetes associated with pancreatic agenesis
26151762 Loss of Ptf1a alone is sufficient to induce acinar-to-ductal metaplasia, potentiate inflammation, and induce a KRAS-permissive, pancreatic ductal adenocarcinoma-like gene expression profile.
25775927 The results of the present study do not support the hypothesis that high penetrant mutations in these regions of PTF1A are involved in the development of human VATER/VACTERL association or NTDs
25355311 ata indicate that E3 ubiquitin ligase thyroid hormone receptor-interacting protein 12 (TRIP12) promotes proteasomal degradation of pancreas transcription factor 1a (PTF1a)and regulates PTF1a activities.
24212882 Recessive mutations in a distal PTF1A enhancer cause isolated pancreatic agenesis.
23339455 ICAT is a novel Ptf1a interactor that regulates pancreatic acinar differentiation and displays altered expression.
20668890 ptf1a functions as a "pancreatic determiner".
19741120 Two separable genomic regions code for initiation and positive feedback of Ptf1a transgene expression in the developing nervous system.
19650412 Here we report a new case of cerebellar agenesis and neonatal diabetes mellitus whose parents are PTF1A mutation carriers.
More...

AA Sequence

MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLL      1 - 70
QPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRG     71 - 140
LSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIG    141 - 210
YINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHS    211 - 280
LSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS                          281 - 328
//

Text Mined References (23)

PMID Year Title
26937009 2016 Loss of Ptf1a Leads to a Widespread Cell-Fate Misspecification in the Brainstem, Affecting the Development of Somatosensory and Viscerosensory Nuclei.
26184423 2015 Variable Phenotype of Diabetes Mellitus in Siblings with a Homozygous PTF1A Enhancer Mutation.
26151762 2015 The acinar differentiation determinant PTF1A inhibits initiation of pancreatic ductal adenocarcinoma.
25775927 2015 Mutations in PTF1A are not a common cause for human VATER/VACTERL association or neural tube defects mirroring Danforth's short tail mouse.
25355311 2014 The E3 ubiquitin ligase thyroid hormone receptor-interacting protein 12 targets pancreas transcription factor 1a for proteasomal degradation.
24212882 2014 Recessive mutations in a distal PTF1A enhancer cause isolated pancreatic agenesis.
23339455 2013 ICAT is a novel Ptf1a interactor that regulates pancreatic acinar differentiation and displays altered expression in tumours.
20668890 2011 Genetic lineage tracing, a powerful tool to investigate the embryonic organogenesis and adult organ maintenance of the pancreas.
19741120 2009 Multiple transcriptional mechanisms control Ptf1a levels during neural development including autoregulation by the PTF1-J complex.
19650412 2009 A Turkish newborn infant with cerebellar agenesis/neonatal diabetes mellitus and PTF1A mutation.
More...