Property Summary

NCBI Gene PubMed Count 15
Grant Count 38
R01 Count 38
Funding $5,376,618.9
PubMed Score 19.07
PubTator Score 16.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Gene RIF (8)

PMID Text
22495370 noted a higher mean value of microvascular density in CK5/6 and Ep-CAM-immunopositive tumors, carcinomas with aberrant CK8/18 expression, and carcinomas with no or strong expression of MMP-2 in stromal fibroblast-like cells
22374815 Activation of protein kinase Cdelta leads to increased pancreatic acinar cell dedifferentiation in the absence of MIST1.
21907708 Chief cells emerge from the Mist.
21098683 MIST1 is enriched upon plasma cell differentiation.
20709804 Our findings implicate MIST1 as a reliable marker of mature, healthy chief cells, and we provide the first evidence that metaplasia in humans arises at least in part from the chief cell lineage.
20382342 Observational study of gene-disease association. (HuGE Navigator)
20038531 MIST1 binds to highly conserved CATATG E-boxes to directly activate transcription of 6 genes, including those encoding the small GTPases RAB26 and RAB3D.
16645041 Mist1 within the hierarchy of known helix-loop-helix/basic helix-loop-helix proteins that control mammary epithelial cell development

AA Sequence

MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRR      1 - 70
DSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLP     71 - 140
GLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT                         141 - 189
//

Text Mined References (16)

PMID Year Title
22495370 2012 MIST1-a novel marker of plasmacytic differentiation.
22374815 2012 Activation of protein kinase C? leads to increased pancreatic acinar cell dedifferentiation in the absence of MIST1.
21907708 2011 The origin of pre-neoplastic metaplasia in the stomach: chief cells emerge from the Mist.
21269460 2011 Initial characterization of the human central proteome.
21098683 2011 Transcription factor MIST1 in terminal differentiation of mouse and human plasma cells.
20709804 2010 The transcription factor MIST1 is a novel human gastric chief cell marker whose expression is lost in metaplasia, dysplasia, and carcinoma.
20382342 2010 Body mass index and von Hippel-Lindau gene mutations in clear-cell renal cancer: Results of the Netherlands Cohort Study on diet and cancer.
20038531 2010 RAB26 and RAB3D are direct transcriptional targets of MIST1 that regulate exocrine granule maturation.
18557763 2008 Phylogenetic and expression analysis of the basic helix-loop-helix transcription factor gene family: genomic approach to cellular differentiation.
16645041 2006 Identification of a basic helix-loop-helix transcription factor expressed in mammary gland alveolar cells and required for maintenance of the differentiated state.
More...