Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.82
PubTator Score 16.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.6e-08

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.6e-08

Gene RIF (8)

AA Sequence

MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRR      1 - 70
DSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLP     71 - 140
GLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT                         141 - 189
//

Text Mined References (16)

PMID Year Title