Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.69
PubTator Score 1.83

Knowledge Summary

Patent (1,112)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pelvic inflammatory disease 21 3.94 2.0

Gene RIF (2)

PMID Text
23632330 Further studies revealed that TAS2R41 is a 'specialist' receptor highly selective for this antibiotic.
22397221 Our results show that the expression rate of some of the T2R taste receptor genes was increased significantly in patients with phantogeusia.

AA Sequence

MATELDKIFLILAIAEFIISMLGNVFIGLVNCSEGIKNQKVFSADFILTCLAISTIGQLLVILFDSFLVG      1 - 70
LASHLYTTYRLGKTVIMLWHMTNHLTTWLATCLSIFYFFKIAHFPHSLFLWLRWRMNGMIVMLLILSLFL     71 - 140
LIFDSLVLEIFIDISLNIIDKSNLTLYLDESKTLYDKLSILKTLLSLTSFIPFSLFLTSLLFLFLSLVRH    141 - 210
TRNLKLSSLGSRDSSTEAHRRAMKMVMSFLFLFIVHFFSLQVANGIFFMLWNNKYIKFVMLALNAFPSCH    211 - 280
SFILILGNSKLRQTAVRLLWHLRNYTKTPNALPL                                        281 - 314
//

Text Mined References (9)

PMID Year Title
23632330 2013 Major haplotypes of the human bitter taste receptor TAS2R41 encode functional receptors for chloramphenicol.
22397221 2012 Patients with phantogeusia show increased expression of T2R taste receptor genes in their tongues.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
16541075 2006 The finished DNA sequence of human chromosome 12.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679530 2003 Adaptive diversification of bitter taste receptor genes in Mammalian evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.