Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.10
PubTator Score 1.83

Knowledge Summary

Patent (1,112)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Pelvic inflammatory disease 21 3.94 2.0

Gene RIF (2)

AA Sequence

MATELDKIFLILAIAEFIISMLGNVFIGLVNCSEGIKNQKVFSADFILTCLAISTIGQLLVILFDSFLVG      1 - 70
LASHLYTTYRLGKTVIMLWHMTNHLTTWLATCLSIFYFFKIAHFPHSLFLWLRWRMNGMIVMLLILSLFL     71 - 140
LIFDSLVLEIFIDISLNIIDKSNLTLYLDESKTLYDKLSILKTLLSLTSFIPFSLFLTSLLFLFLSLVRH    141 - 210
TRNLKLSSLGSRDSSTEAHRRAMKMVMSFLFLFIVHFFSLQVANGIFFMLWNNKYIKFVMLALNAFPSCH    211 - 280
SFILILGNSKLRQTAVRLLWHLRNYTKTPNALPL                                        281 - 314
//

Text Mined References (9)

PMID Year Title