Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.361 0.000
interstitial cystitis 2.200 0.001
primary Sjogren syndrome 2.600 0.000

Gene RIF (7)

PMID Text
26763980 NLRX1, NLRP12 and NLRC3 negatively modulate the host immune response following virus exposure. (Review)
26378020 The extent of NLRC3 and AIM2 gene reduction was correlated with cancer progression.
25277106 overexpression of NLRC3 with NLRP3/cryopyrin inflammasome components suppresses pro-caspase-1 cleavage and IL-1beta processing.
22863753 NLRC3 inhibited Toll-like receptor (TLR)-dependent activation of the transcription factor NF-kappaB by interacting with the TLR signaling adaptor TRAF6
22718770 Post-transcriptional inhibition of luciferase reporter assays by the Nod-like receptor proteins NLRX1 and NLRC3.
18976975 Knockdown of NLR family, CARD domain containing 3 (NLRC3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15705585 This report describes the first cloning and characterization of a novel CATERPILLER gene, CLR16.2 that is located on human chromosome 16. The protein encoded by this gene has a typical NBD-LRR configuration.

AA Sequence

MRKQEVRTGREAGQGHGTGSPAEQVKALMDLLAGKGSQGSQAPQALDRTPDAPLGPCSNDSRIQRHRKAL      1 - 70
LSKVGGGPELGGPWHRLASLLLVEGLTDLQLREHDFTQVEATRGGGHPARTVALDRLFLPLSRVSVPPRV     71 - 140
SITIGVAGMGKTTLVRHFVRLWAHGQVGKDFSLVLPLTFRDLNTHEKLCADRLICSVFPHVGEPSLAVAV    141 - 210
PARALLILDGLDECRTPLDFSNTVACTDPKKEIPVDHLITNIIRGNLFPEVSIWITSRPSASGQIPGGLV    211 - 280
DRMTEIRGFNEEEIKVCLEQMFPEDQALLGWMLSQVQADRALYLMCTVPAFCRLTGMALGHLWRSRTGPQ    281 - 350
DAELWPPRTLCELYSWYFRMALSGEGQEKGKASPRIEQVAHGGRKMVGTLGRLAFHGLLKKKYVFYEQDM    351 - 420
KAFGVDLALLQGAPCSCFLQREETLASSVAYCFTHLSLQEFVAAAYYYGASRRAIFDLFTESGVSWPRLG    421 - 490
FLTHFRSAAQRAMQAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAQGEHQAYRTQVAELLQGCLRPDAAV    491 - 560
CARAINVLHCLHELQHTELARSVEEAMESGALARLTGPAHRAALAYLLQVSDACAQEANLSLSLSQGVLQ    561 - 630
SLLPQLLYCRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLD    631 - 700
LRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRM    701 - 770
ADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLS    771 - 840
LRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQAL    841 - 910
GQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILD    911 - 980
LRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGARMI    981 - 1050
SEAIKTNAPTCTVEM                                                          1051 - 1065
//

Text Mined References (13)

PMID Year Title
26763980 2016 Beyond the inflammasome: regulatory NOD-like receptor modulation of the host immune response following virus exposure.
26378020 2015 Expression profile of innate immune receptors, NLRs and AIM2, in human colorectal cancer: correlation with cancer stages and inflammasome components.
25277106 2015 Overexpressed NLRC3 acts as an anti-inflammatory cytosolic protein.
24560620 2014 NLRC3, a member of the NLR family of proteins, is a negative regulator of innate immune signaling induced by the DNA sensor STING.
24062750 2013 Unsolved Mysteries in NLR Biology.
22863753 2012 The innate immune sensor NLRC3 attenuates Toll-like receptor signaling via modification of the signaling adaptor TRAF6 and transcription factor NF-?B.
22718770 2012 Post-transcriptional inhibition of luciferase reporter assays by the Nod-like receptor proteins NLRX1 and NLRC3.
17925653 Downregulation of immune signaling genes in patients with large surface burn injury.
15771576 2005 CATERPILLER: a novel gene family important in immunity, cell death, and diseases.
15705585 2005 CATERPILLER 16.2 (CLR16.2), a novel NBD/LRR family member that negatively regulates T cell function.
More...