Property Summary

NCBI Gene PubMed Count 28
PubMed Score 24.17
PubTator Score 46.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.800 5.5e-07
astrocytic glioma -1.600 1.6e-02
Astrocytoma, Pilocytic -1.300 3.9e-08
atypical teratoid / rhabdoid tumor -1.300 2.2e-06
ependymoma -1.900 1.5e-02
glioblastoma -1.500 1.3e-08
intraductal papillary-mucinous adenoma (... 1.200 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.500 4.1e-03
medulloblastoma -1.300 3.0e-03
medulloblastoma, large-cell -2.000 7.4e-05
oligodendroglioma -1.100 1.7e-11
osteosarcoma -1.840 4.8e-04
primitive neuroectodermal tumor -1.200 8.0e-04
subependymal giant cell astrocytoma -1.940 2.7e-02

Gene RIF (20)

AA Sequence

MGTAAAAAAAAAAAAAGEGARSPSPAAVSLGLGVAVVSSLVNGSTFVLQKKGIVRAKRRGTSYLTDIVWW      1 - 70
AGTIAMAVGQIGNFLAYTAVPTVLVTPLGALGVPFGSILASYLLKEKLNILGKLGCLLSCAGSVVLIIHS     71 - 140
PKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMVYISICSLLGSFTVPSTKGIG    141 - 210
LAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILF    211 - 280
REWSNVGLVDFLGMACGFTTVSVGIVLIQVFKEFNFNLGEMNKSNMKTD                         281 - 329
//

Text Mined References (30)

PMID Year Title