Property Summary

NCBI Gene PubMed Count 26
PubMed Score 26.93
PubTator Score 20.45

Knowledge Summary

Patent (3,680)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.423 2.2e-06

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYE      1 - 70
LLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIAD     71 - 140
NELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVY    141 - 210
LSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFK    211 - 280
DMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSP    281 - 350
HFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTN    351 - 420
LEELEVDDWEF                                                               421 - 431
//

Text Mined References (32)

PMID Year Title