Property Summary

NCBI Gene PubMed Count 25
Grant Count 32
R01 Count 17
Funding $4,235,349.87
PubMed Score 23.34
PubTator Score 20.45

Knowledge Summary

Patent (3,680)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.423 0.000

Gene RIF (9)

PMID Text
20424326 aberrant nuclear accumulation of LKB1 caused by STRADalpha deficiency contributes to hyperactivation of mTORC1 signaling and disruption of neuronal lamination during corticogenesis
19892943 study describes structure of the core heterotrimeric LKB1-STRADalpha-MO25alpha complex, revealing an unusual allosteric mechanism of LKB1 activation; structure also reveals how mutations in Peutz-Jeghers syndrome & sporadic cancers impair LKB1 function
19513107 ATP and MO25alpha cooperate to maintain STRADalpha in an "active" closed conformation required for LKB1 activation.
19386264 These data define a brush border induction pathway downstream of the Lkb1/Strad/Mo25 polarization complex, yet separate from other polarity events.
18854318 STRADalpha.MO25alpha complexes containing LKB1 variants were equally effective at phosphorylating and activating AMPK, BRSK1, and BRSK2
18687677 LKB1 deacetylation is regulated by SIRT1 and that this in turn influences its intracellular localization, association with STRAD, kinase activity, and ability to activate AMPK.
18256292 identify a multifactored mechanism to control LKB1 localization, and they suggest that the STRADbeta-LKB1 complex might possess unique functions in the nucleus
17921699 Several novel splice isoforms of STRADalpha that differentially affect the kinase activity, complex assembly, subcellular localization of LKB1 and the activation of the LKB1-dependent AMPK pathway were discovered.
12805220 Identification and characterization of an LKB1-specific adaptor protein and substrate, STRAD. Results imply that STRAD plays a key role in regulating the tumor suppressor activities of LKB1.

AA Sequence

MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYE      1 - 70
LLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIAD     71 - 140
NELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVY    141 - 210
LSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFK    211 - 280
DMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSP    281 - 350
HFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTN    351 - 420
LEELEVDDWEF                                                               421 - 431
//

Text Mined References (31)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21423148 2011 MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.
20562859 2010 Network organization of the human autophagy system.
20424326 2010 STRADalpha deficiency results in aberrant mTORC1 signaling during corticogenesis in humans and mice.
19892943 2009 Structure of the LKB1-STRAD-MO25 complex reveals an allosteric mechanism of kinase activation.
19513107 2009 ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor.
19386264 2009 Mst4 and Ezrin induce brush borders downstream of the Lkb1/Strad/Mo25 polarization complex.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...