Property Summary

NCBI Gene PubMed Count 6
PubMed Score 236.79
PubTator Score 11.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 4.00818270191703E-40
posterior fossa group B ependymoma 1530 2.56356739651094E-4
sonic hedgehog group medulloblastoma 1482 0.0070807812934669
subependymal giant cell astrocytoma 2287 0.0311731915566597
Disease Target Count Z-score Confidence
Gout 93 0.0 1.0
Disease Target Count Z-score Confidence
Congestive heart failure 36 4.041 2.0
Otitis externa 9 3.311 1.7

Expression

  Differential Expression (4)

Synonym

Accession Q7M4L6 Q96IE8
Symbols

Gene

SHF

  Ortholog (4)

Species Source
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG

Gene RIF (1)

PMID Text
23360421 Patients showing high ALK and low Shf mRNA expressions showed poor prognosis.

AA Sequence

MQQEGGPVRSAPCRTGTLEGSRQGSPGHRKRASPKGSLSSAQPHSWMLTPSPLNSHCAHREPISSSPQPV      1 - 70
ANGPKQKKKSNWRSTTRLRIIRLRDRLEPRPLAILEDYADPFDVQETGEGSAGASGAPEKVPENDGYMEP     71 - 140
YEAQKMMAEIRGSKETATQPLPLYDTPYEPEEDGATAEGEGAPWPRESRLPEDDERPPEEYDQPWEWKKE    141 - 210
RISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGRE    211 - 280
EKGRLPPRLSAGNPKSAKPLSMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNS    281 - 350
ETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAI    351 - 420
RTL                                                                       421 - 423
//

Text Mined References (8)

PMID Year Title
23360421 2013 Novel adaptor protein Shf interacts with ALK receptor and negatively regulates its downstream signals in neuroblastoma.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11095946 2000 Shf, a Shb-like adapter protein, is involved in PDGF-alpha-receptor regulation of apoptosis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.