Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.94
PubTator Score 5.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.500 2.0e-02
Astrocytoma, Pilocytic 1.400 4.4e-05
colon cancer 1.200 5.1e-03
ependymoma 1.400 3.1e-08
glioblastoma 1.100 1.8e-04
group 4 medulloblastoma -1.100 7.6e-03
lung adenocarcinoma 1.049 2.0e-03
lung cancer 1.600 9.3e-05
lung carcinoma 1.200 1.7e-27
Multiple myeloma 1.214 2.7e-02
non primary Sjogren syndrome sicca -1.400 2.5e-02
oligodendroglioma -1.400 2.8e-02
osteosarcoma 1.507 1.3e-03
ovarian cancer -1.300 5.6e-05
pediatric high grade glioma 1.500 1.1e-05
pituitary cancer 1.300 1.6e-04
psoriasis -1.100 3.7e-07

Protein-protein Interaction (11)

Gene RIF (4)

AA Sequence

MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDE      1 - 70
EEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYH     71 - 140
GHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCA    141 - 210
PEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYR    211 - 280
TGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEK    281 - 350
IYPKSN                                                                    351 - 356
//

Text Mined References (14)

PMID Year Title