Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.32
PubTator Score 5.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.67719068475295E-27
ependymoma 2514 3.06653549776079E-8
ovarian cancer 8492 8.56588062793748E-7
pediatric high grade glioma 2712 1.12324850974616E-5
pituitary cancer 1972 4.37746338372571E-5
lung cancer 4473 9.3286146362908E-5
pilocytic astrocytoma 3086 1.02244678203952E-4
glioblastoma 5572 4.87688711953642E-4
medulloblastoma 1524 7.19893002794914E-4
osteosarcoma 7933 0.00134183105734063
lung adenocarcinoma 2714 0.00196835423491747
colon cancer 1475 0.00512340135417912
psoriasis 6685 0.00564522507172038
astrocytic glioma 2241 0.0200335889424355
non primary Sjogren syndrome sicca 840 0.0250089987182307
Multiple myeloma 1328 0.0273163039385598
oligodendroglioma 2849 0.0281638100767384
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 1.0

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.214 0.027
astrocytic glioma -1.500 0.020
oligodendroglioma -1.400 0.028
psoriasis -1.300 0.006
osteosarcoma 1.507 0.001
ependymoma 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma -1.400 0.001
colon cancer 1.200 0.005
lung cancer 1.600 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.400 0.000
non primary Sjogren syndrome sicca -1.400 0.025
lung adenocarcinoma 1.049 0.002
lung carcinoma 1.200 0.000
ovarian cancer -1.900 0.000
pituitary cancer 1.500 0.000

Synonym

Gene

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (4)

PMID Text
25594747 C5-epimerase and 2-O-sulfotransferase in association generate extended domains of consecutive GlcNS-IdoA2S Sequence.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17227754 analysis of differences and similarities various residues play in the biological roles of the HS-2OST and CS-2OST enzymes

AA Sequence

MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDE      1 - 70
EEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYH     71 - 140
GHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCA    141 - 210
PEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYR    211 - 280
TGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEK    281 - 350
IYPKSN                                                                    351 - 356
//

Text Mined References (14)

PMID Year Title
25594747 2015 C5-epimerase and 2-O-sulfotransferase associate in vitro to generate contiguous epimerized and 2-O-sulfated heparan sulfate domains.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
17227754 2007 Mutational study of heparan sulfate 2-O-sulfotransferase and chondroitin sulfate 2-O-sulfotransferase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15317737 2005 Occurrence of sulfated galactans in marine angiosperms: evolutionary implications.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...