Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $45,267.25
PubMed Score 0.32
PubTator Score 5.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.214 0.027
astrocytic glioma -1.500 0.020
oligodendroglioma -1.400 0.028
psoriasis -1.300 0.006
osteosarcoma 1.507 0.001
ependymoma 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma -1.400 0.001
colon cancer 1.200 0.005
lung cancer 1.600 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.400 0.000
non primary Sjogren syndrome sicca -1.400 0.025
lung adenocarcinoma 1.049 0.002
lung carcinoma 1.200 0.000
ovarian cancer -1.900 0.000
pituitary cancer 1.500 0.000

Synonym

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
25594747 C5-epimerase and 2-O-sulfotransferase in association generate extended domains of consecutive GlcNS-IdoA2S Sequence.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17227754 analysis of differences and similarities various residues play in the biological roles of the HS-2OST and CS-2OST enzymes

AA Sequence

MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDE      1 - 70
EEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYH     71 - 140
GHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCA    141 - 210
PEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYR    211 - 280
TGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEK    281 - 350
IYPKSN                                                                    351 - 356
//

Text Mined References (14)

PMID Year Title
25594747 2015 C5-epimerase and 2-O-sulfotransferase associate in vitro to generate contiguous epimerized and 2-O-sulfated heparan sulfate domains.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
17227754 2007 Mutational study of heparan sulfate 2-O-sulfotransferase and chondroitin sulfate 2-O-sulfotransferase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15317737 2005 Occurrence of sulfated galactans in marine angiosperms: evolutionary implications.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...