Property Summary

NCBI Gene PubMed Count 20
PubMed Score 121.76
PubTator Score 27.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 3.2e-03
cystic fibrosis -1.438 3.1e-06
group 4 medulloblastoma 1.400 7.4e-04
nasopharyngeal carcinoma -1.300 9.4e-04
osteosarcoma 2.128 1.4e-05
ovarian cancer 2.100 5.4e-08
Polycystic ovary syndrome -1.004 2.3e-02
posterior fossa group A ependymoma 1.100 4.3e-05

Gene RIF (9)

AA Sequence

MSSLGGGSQDAGGSSSSSTNGSGGSGSSGPKAGAADKSAVVAAAAPASVADDTPPPERRNKSGIISEPLN      1 - 70
KSLRRSRPLSHYSSFGSSGGSGGGSMMGGESADKATAAAAAASLLANGHDLAAAMAVDKSNPTSKHKSGA     71 - 140
VASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPY    141 - 210
LGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSS    211 - 280
CRNRKTGHQICKFRKCEELKKKPSAALEKVMLPTGAAFRWFQ                                281 - 322
//

Text Mined References (23)

PMID Year Title