Property Summary

NCBI Gene PubMed Count 20
Grant Count 60
R01 Count 4
Funding $11,958,930.34
PubMed Score 109.50
PubTator Score 27.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 2.128 0.000
cystic fibrosis -1.439 0.000
atypical teratoid/rhabdoid tumor -2.200 0.000
group 4 medulloblastoma 1.400 0.001
posterior fossa group A ependymoma 1.100 0.000
nasopharyngeal carcinoma -1.300 0.001
Polycystic Ovary Syndrome -1.004 0.023
ovarian cancer 3.800 0.000

Gene RIF (9)

PMID Text
25805812 Low CXXC5 expression is associated with acute myeloid leukemia.
25605239 High CXXC5 expression seems to affect several steps in human leukemogenesis, including intracellular events as well as extracellular communication.
25433557 Findings suggest that overexpression of CXXC5 in C2C12 myoblasts facilitated myocyte differentiation, while RNAi interference of CXXC5 significantly inhibited the differentiation of C2C12 myoblasts.
23988457 targeting of CXXC5/RINF should be considered as a possible therapeutic strategy, especially in high-risk patients who show increased expression in AML cells compared with normal hematopoietic cells
23190153 Lack of promoter hypermethylation or somatic mutations are found in the potential tumor suppressor CXXC5 in myelodysplastic syndromes or acute myeloid leukemia with deletion 5q.
21325450 RINF overexpression represents an independent molecular marker for poor prognosis in breast tumors.
19865112 Observational study of gene-disease association. (HuGE Navigator)
19557330 These findings suggest that CF5 plays a crucial role in ATM-p53 signaling in response to DNA damage.
19182210 RINF expression correlates with retinoid-induced differentiation of leukemic cells and with cytokine-induced myelopoiesis of normal CD34(+) progenitors.

AA Sequence

MSSLGGGSQDAGGSSSSSTNGSGGSGSSGPKAGAADKSAVVAAAAPASVADDTPPPERRNKSGIISEPLN      1 - 70
KSLRRSRPLSHYSSFGSSGGSGGGSMMGGESADKATAAAAAASLLANGHDLAAAMAVDKSNPTSKHKSGA     71 - 140
VASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPY    141 - 210
LGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSS    211 - 280
CRNRKTGHQICKFRKCEELKKKPSAALEKVMLPTGAAFRWFQ                                281 - 322
//

Text Mined References (23)

PMID Year Title
26056233 2015 The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.
25805812 2015 Downregulation of the Wnt inhibitor CXXC5 predicts a better prognosis in acute myeloid leukemia.
25605239 2015 Expression of the potential therapeutic target CXXC5 in primary acute myeloid leukemia cells - high expression is associated with adverse prognosis as well as altered intracellular signaling and transcriptional regulation.
25433557 2014 CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.
23988457 2013 CXXC5 (retinoid-inducible nuclear factor, RINF) is a potential therapeutic target in high-risk human acute myeloid leukemia.
23303788 2013 Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.
23190153 2013 Downregulation but lack of promoter hypermethylation or somatic mutations of the potential tumor suppressor CXXC5 in MDS and AML with deletion 5q.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21325450 2011 RINF (CXXC5) is overexpressed in solid tumors and is an unfavorable prognostic factor in breast cancer.
20220130 2010 A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.
More...