Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
Funding $24,758.01
PubMed Score 13.55
PubTator Score 18.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 3.800 0.000
cutaneous lupus erythematosus 1.300 0.005
osteosarcoma -4.080 0.000
cystic fibrosis -1.264 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.600 0.000
adrenocortical carcinoma -1.177 0.000
non-small cell lung cancer -1.566 0.000
interstitial cystitis 1.800 0.002
lung adenocarcinoma -1.700 0.000

Synonym

Accession Q7LDG7 A6NDC7 O00538 Q9UL65
Symbols CDC25L
CALDAG-GEFI

Gene

PDB

2MA2  

Gene RIF (6)

PMID Text
24958846 Human CalDAG-GEFI gene (RASGRP2) mutation affects platelet function and causes severe bleeding.
23611601 phosphorylation of CalDAG-GEFI is a critical mechanism by which PKA controls Rap1b-dependent platelet aggregation
23563504 RasGRP2 increases cell viability and cell-matrix adhesion through increased Ras expression and Rap1 activation, respectively, in endothelial cells.
23530823 NIH3T3 cells were found nonpermissive to mtHSV but they became permissive following transformation with the Rasgrp2 gene. This effect was linked to the activation of the Ras-PKR signaling pathway.
20606303 analyzed the 5'-flanking region of rasgrp2 gene by a luciferase assay, which revealed that not only a promoter but also silencer regions were present upstream of D1E, suggesting rasgrp2 expression is controlled by a combination of promotion and repression
12239348 CalDAG-GEFI plays a role in inside-out signaling to alphaIIbbeta3

AA Sequence

MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS      1 - 70
LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG     71 - 140
QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM    141 - 210
ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV    211 - 280
TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL    281 - 350
RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ    351 - 420
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV    421 - 490
LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS    491 - 560
APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL                         561 - 609
//

Text Mined References (28)

PMID Year Title
24958846 2014 Human CalDAG-GEFI gene (RASGRP2) mutation affects platelet function and causes severe bleeding.
23908768 2013 Structural analysis of autoinhibition in the Ras-specific exchange factor RasGRP1.
23611601 2013 Phosphorylation of CalDAG-GEFI by protein kinase A prevents Rap1b activation.
23563504 Ras guanyl nucleotide releasing protein 2 affects cell viability and cell-matrix adhesion in ECV304 endothelial cells.
23530823 2013 Rasgrp2 regulates the permissiveness of NIH3T3 cells to a herpes simplex virus 1 mutant with inactivated ICP34.5 gene.
21768215 2011 Genome-wide association study for serum urate concentrations and gout among African Americans identifies genomic risk loci and a novel URAT1 loss-of-function allele.
20606303 2010 Identification of the gene regulatory region in human rasgrp2 gene in vascular endothelial cells.
19234463 2009 Leukocyte adhesion deficiency-III is caused by mutations in KINDLIN3 affecting integrin activation.
19234460 2009 A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans.
19064721 2009 LAD-1/variant syndrome is caused by mutations in FERMT3.
More...