Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.90
PubTator Score 18.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.177 7.6e-06
atypical teratoid / rhabdoid tumor -1.300 2.6e-06
cutaneous lupus erythematosus 1.300 4.8e-03
cystic fibrosis -1.264 1.6e-04
interstitial cystitis 1.500 2.4e-03
lung adenocarcinoma -1.700 1.0e-07
malignant mesothelioma 2.400 2.0e-06
medulloblastoma, large-cell -1.600 1.8e-04
non-small cell lung cancer -1.246 3.1e-29
osteosarcoma -4.080 4.7e-08

Gene RIF (10)

AA Sequence

MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS      1 - 70
LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG     71 - 140
QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM    141 - 210
ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV    211 - 280
TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL    281 - 350
RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ    351 - 420
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV    421 - 490
LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS    491 - 560
APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL                         561 - 609
//

Text Mined References (34)

PMID Year Title