Property Summary

NCBI Gene PubMed Count 24
PubMed Score 188.94
PubTator Score 75.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 3.1e-02
Down syndrome -1.100 7.3e-04
group 4 medulloblastoma -3.000 1.2e-03
inflammatory breast cancer -1.700 7.7e-07
invasive ductal carcinoma -2.001 3.0e-03
lung adenocarcinoma -1.800 8.1e-17
non-small cell lung cancer -1.503 1.4e-18
osteosarcoma 1.231 2.6e-05
pituitary cancer -3.300 9.7e-06
posterior fossa group A ependymoma -1.200 2.6e-02

Gene RIF (16)

AA Sequence

MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERELKGLHRSVGK      1 - 70
LESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVFYRLERWADRLESTGGKYPVG     71 - 140
SESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVD    141 - 210
TQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLS    211 - 280
REAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQ    281 - 350
RGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE                            351 - 396
//

Text Mined References (24)

PMID Year Title