Property Summary

NCBI Gene PubMed Count 21
Grant Count 79
R01 Count 37
Funding $17,064,873.36
PubMed Score 167.80
PubTator Score 75.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.231 0.000
group 4 medulloblastoma -3.000 0.001
atypical teratoid/rhabdoid tumor -2.000 0.006
non-small cell lung cancer -1.503 0.000
posterior fossa group B ependymoma -2.000 0.000
lung adenocarcinoma -1.800 0.000
invasive ductal carcinoma -2.001 0.003
inflammatory breast cancer -1.700 0.000
pituitary cancer -3.300 0.000
Down syndrome -1.100 0.001

Synonym

Accession Q7LC44 Q9UJW6 Q9Y469
Symbols Arg3.1

Gene

ARC

Gene RIF (14)

PMID Text
26995091 ARC confers resistance to sunitinib in renal cell carcinoma through alternate angiogenesis pathways
26516611 We tested whether ARC variants are associated with six measures of cognitive functioning in 670 healthy subjects in the Norwegian Cognitive NeuroGenetics (NCNG) by extracting data from its Genome-Wide Association Study (GWAS).
26474411 this is the first report associating an ARC SNP with schizophrenia and supports recent large-scale GWAS findings implicating the ARC complex in schizophrenia risk
26380114 we propose that the peculiar characteristics of Arc protein, such as its optimal expression after ongoing experience or familiar behavior could explain how familiarization and recognition memories are stored and preserved in the mammalian brain--{REVIEW}
26038830 mRNA levels of ARC and SGK1 did not differ significantly between the schizophrenia or control samples.
25748042 Arc is a flexible multi-domain protein that exists in monomeric and oligomeric forms, compatible with a diverse, hub-like role in plasticity-related processes.
25344068 Results show that in response to DNA damage, p53 total levels increase proportionally to the strength of the damage; however, p53 tetramers are formed at a constant rate under the control of ARC protein.
24945773 Degradation of Arc by clathrin-localized Triad3A regulates the availability of synaptic AMPA receptors.
22622366 we report a novel ARC single nucleotide polymorphism associated with a reduced risk of developing Alzheimer disease.
22584581 analysis of dynamic, multifaceted control of Arc synthesis during mAchR signaling
More...

AA Sequence

MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERELKGLHRSVGK      1 - 70
LESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVFYRLERWADRLESTGGKYPVG     71 - 140
SESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVD    141 - 210
TQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLS    211 - 280
REAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQ    281 - 350
RGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE                            351 - 396
//

Text Mined References (21)

PMID Year Title
26995091 2016 Decreased apoptosis repressor with caspase recruitment domain confers resistance to sunitinib in renal cell carcinoma through alternate angiogenesis pathways.
26516611 2015 Common variants in the ARC gene are not associated with cognitive abilities.
26474411 2015 Association of SNPs in EGR3 and ARC with Schizophrenia Supports a Biological Pathway for Schizophrenia Risk.
26380114 2015 New Insights on Retrieval-Induced and Ongoing Memory Consolidation: Lessons from Arc.
26038830 2015 Altered Markers of Cortical ?-Aminobutyric Acid Neuronal Activity in Schizophrenia: Role of the NARP Gene.
25748042 2015 Arc is a flexible modular protein capable of reversible self-oligomerization.
25344068 2014 Constant rate of p53 tetramerization in response to DNA damage controls the p53 response.
24945773 2014 Triad3A regulates synaptic strength by ubiquitination of Arc.
22622366 2012 A novel ARC gene polymorphism is associated with reduced risk of Alzheimer's disease.
22584581 2012 Balancing Arc synthesis, mRNA decay, and proteasomal degradation: maximal protein expression triggered by rapid eye movement sleep-like bursts of muscarinic cholinergic receptor stimulation.
More...