Property Summary

NCBI Gene PubMed Count 40
PubMed Score 3.70
PubTator Score 8.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.312 1.4e-05
interstitial lung disease -1.100 1.5e-02
lung cancer 1.300 3.4e-03
malignant mesothelioma 1.100 2.5e-05
osteosarcoma 1.387 1.1e-05
tuberculosis -1.100 3.9e-05

Gene RIF (11)

AA Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSA      1 - 70
RVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT     71 - 140
TLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV               141 - 199
//

Text Mined References (42)

PMID Year Title