Property Summary

NCBI Gene PubMed Count 38
Grant Count 2
R01 Count 2
Funding $149,000
PubMed Score 3.98
PubTator Score 8.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease -1.100 0.015
malignant mesothelioma 1.100 0.000
osteosarcoma 1.387 0.000
acute quadriplegic myopathy 1.544 0.000
tuberculosis -1.100 0.000
lung cancer 1.300 0.003

Synonym

Accession Q7LBR1 Q96E89 Q9HD41
Symbols Vps46B
C10orf2
C18orf2
CHMP1.5
Vps46-2
C18-ORF2
hVps46-2

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

3JC1   4TXR   3EAB   4TXQ  

Gene RIF (11)

PMID Text
22754649 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21762798 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21762796 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21616915 The interaction between CL7MIT and CHMP1B and between CL7MIT and IST1 became stronger when IST1 or CHMP1B was additionally coexpressed, suggesting formation of ternary complex of calpain-7, IST1 and CHMP1B.
21494275 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21394083 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
19328558 Observational study of gene-disease association. (HuGE Navigator)
18997780 The 2.5-A structure of the C-terminal tail of CHMP1B with the MIT domain of spastin reveals a specific, high-affinity complex involving a noncanonical binding site between the first and third helices of the MIT domain.
17711858 UBPY MIT domain and another ubiquitin isopeptidase, AMSH, reveals common interactions with CHMP1A and CHMP1B but a distinct selectivity of AMSH for CHMP3/VPS24, a core subunit of the ESCRT-III complex, and UBPY for CHMP7.
16174732 CHMP1B is bound by the VPS4A microtubule interacting and transport (MIT) domain.
More...

AA Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSA      1 - 70
RVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT     71 - 140
TLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV               141 - 199
//

Text Mined References (40)

PMID Year Title
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
23015756 2012 MITD1 is recruited to midbodies by ESCRT-III and participates in cytokinesis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...