Property Summary

NCBI Gene PubMed Count 38
PubMed Score 3.98
PubTator Score 8.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
acute quadriplegic myopathy 1157 9.5408478353495E-7
osteosarcoma 7933 1.07286442395911E-5
malignant mesothelioma 3163 2.46258475973429E-5
tuberculosis 1563 3.93033318906675E-5
lung cancer 4473 0.00344948961907665
interstitial lung disease 292 0.015010102331441
Disease Target Count Z-score Confidence
Bipolar Disorder 266 3.09 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial lung disease -1.100 0.015
malignant mesothelioma 1.100 0.000
osteosarcoma 1.387 0.000
acute quadriplegic myopathy 1.544 0.000
tuberculosis -1.100 0.000
lung cancer 1.300 0.003

Synonym

Accession Q7LBR1 Q96E89 Q9HD41
Symbols Vps46B
C10orf2
C18orf2
CHMP1.5
Vps46-2
C18-ORF2
hVps46-2

Gene

PANTHER Protein Class (1)

PDB

3JC1   4TXR   3EAB   4TXQ  

  Ortholog (11)

Species Source
Mouse OMA Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (11)

PMID Text
22754649 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21762798 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21762796 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21616915 The interaction between CL7MIT and CHMP1B and between CL7MIT and IST1 became stronger when IST1 or CHMP1B was additionally coexpressed, suggesting formation of ternary complex of calpain-7, IST1 and CHMP1B.
21494275 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
21394083 VPS4A increases co-localization of HIV-1 Gag with the ESCRT proteins Chmp1b, Chmp4b, and Chmp4c at sites of HIV-1 assembly
19328558 Observational study of gene-disease association. (HuGE Navigator)
18997780 The 2.5-A structure of the C-terminal tail of CHMP1B with the MIT domain of spastin reveals a specific, high-affinity complex involving a noncanonical binding site between the first and third helices of the MIT domain.
17711858 UBPY MIT domain and another ubiquitin isopeptidase, AMSH, reveals common interactions with CHMP1A and CHMP1B but a distinct selectivity of AMSH for CHMP3/VPS24, a core subunit of the ESCRT-III complex, and UBPY for CHMP7.
16174732 CHMP1B is bound by the VPS4A microtubule interacting and transport (MIT) domain.
More...

AA Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSA      1 - 70
RVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT     71 - 140
TLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV               141 - 199
//

Text Mined References (40)

PMID Year Title
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
23015756 2012 MITD1 is recruited to midbodies by ESCRT-III and participates in cytokinesis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...