Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
R01 Count 1
Funding $164,831.66
PubMed Score 9.25
PubTator Score 8.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.100 0.011
oligodendroglioma 1.200 0.005
astrocytoma 1.200 0.011
subependymal giant cell astrocytoma -1.110 0.007
ovarian cancer 1.400 0.003

Synonym

Accession Q7LBC6 A6H8X7 Q9BVH6 Q9BW93 Q9BZ52 Q9NYF4 Q9UPS0
Symbols 5qNCA
NET22
C5orf7
JMJD1B

Gene

 Grant Application (2)

PDB

4C8D  

Gene RIF (5)

PMID Text
25413303 H3K9 demethylase KDM3B represses transcription of the angiogenesis regulatory gene, ANGPT1.
23266085 High expression of KDM3B and KDM5A is associated with a better prognosis (no recurrence after mastectomy p=0.005 and response to docetaxel p=0.005)in breast cancer patients.
22615488 evidence that the H3K9-me1/2 demethylase KDM3B might play a role in leukemogenesis via activation of lmo2 through interdependent actions with the histone acetyltransferase complex containing CBP
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11687974 A novel nuclear protein, 5qNCA is a candidate for the myeloid leukemia tumor suppressor gene on chromosome 5 band q31.

AA Sequence

MADAAASPVGKRLLLLFADTAASASASAPAAAAASGDPGPALRTRAWRAGTVRAMSGAVPQDLAIFVEFD      1 - 70
GCNWKQHSWVKVHAEEVIVLLLEGSLVWAPREDPVLLQGIRVSIAQWPALTFTPLVDKLGLGSVVPVEYL     71 - 140
LDRELRFLSDANGLHLFQMGTDSQNQILLEHAALRETVNALISDQKLQEIFSRGPYSVQGHRVKIYQPEG    141 - 210
EEGWLYGVVSHQDSITRLMEVSVTESGEIKSVDPRLIHVMLMDNSAPQSEGGTLKAVKSSKGKKKRESIE    211 - 280
GKDGRRRKSASDSGCDPASKKLKGDRGEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQPPSTFVPQI    281 - 350
NRNIRFATYTKENGRTLVVQDEPVGGDTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLEQVGQGIVAS    351 - 420
AAVVTTASSTPNTVRISDTGLAAGTVPEKQKGSRSQASGENSRNSILASSGFGAPLPSSSQPLTFGSGRS    421 - 490
QSNGVLATENKPLGFSFGCSSAQEAQKDTDLSKNLFFQCMSQTLPTSNYFTTVSESLADDSSSRDSFKQS    491 - 560
LESLSSGLCKGRSVLGTDTKPGSKAGSSVDRKVPAESMPTLTPAFPRSLLNARTPENHENLFLQPPKLSR    561 - 630
EEPSNPFLAFVEKVEHSPFSSFASQASGSSSSATTVTSKVAPSWPESHSSADSASLAKKKPLFITTDSSK    631 - 700
LVSGVLGSALTSGGPSLSAMGNGRSSSPTSSLTQPIEMPTLSSSPTEERPTVGPGQQDNPLLKTFSNVFG    701 - 770
RHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSSTNSDLSDLSDSEEQLQAKTGLKGIPEH    771 - 840
LMGKLGPNGERSAELLLGKSKGKQAPKGRPRTAPLKVGQSVLKDVSKVKKLKQSGEPFLQDGSCINVAPH    841 - 910
LHKCRECRLERYRKFKEQEQDDSTVACRFFHFRRLIFTRKGVLRVEGFLSPQQSDPDAMNLWIPSSSLAE    911 - 980
GIDLETSKYILANVGDQFCQLVMSEKEAMMMVEPHQKVAWKRAVRGVREMCDVCETTLFNIHWVCRKCGF    981 - 1050
GVCLDCYRLRKSRPRSETEEMGDEEVFSWLKCAKGQSHEPENLMPTQIIPGTALYNIGDMVHAARGKWGI   1051 - 1120
KANCPCISRQNKSVLRPAVTNGMSQLPSINPSASSGNETTFSGGGGPAPVTTPEPDHVPKADSTDIRSEE   1121 - 1190
PLKTDSSASNSNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKEAGSLRSVLNKESHSPFGLDSF   1191 - 1260
NSTAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFSTSSAGVKSKA   1261 - 1330
SLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHTSHSWLCDGRLLCLHDPSNKN   1331 - 1400
NWKIFRECWKQGQPVLVSGVHKKLKSELWKPEAFSQEFGDQDVDLVNCRNCAIISDVKVRDFWDGFEIIC   1401 - 1470
KRLRSEDGQPMVLKLKDWPPGEDFRDMMPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKM   1471 - 1540
YNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKP   1541 - 1610
GALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDA   1611 - 1680
VFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNIIYHAVKDAVGT   1681 - 1750
LKAHESKLARS                                                              1751 - 1761
//

Text Mined References (30)

PMID Year Title
25413303 2015 Transcriptional repression of ANGPT1 by histone H3K9 demethylase KDM3B.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23266085 2013 Histone lysine demethylases in breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22615488 2012 KDM3B is the H3K9 demethylase involved in transcriptional activation of lmo2 in leukemia.
21269460 2011 Initial characterization of the human central proteome.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...