Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.89
PubTator Score 2.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.017
osteosarcoma -1.969 0.000
posterior fossa group B ependymoma 1.500 0.000
medulloblastoma, large-cell -1.400 0.002
Amyotrophic Lateral Sclerosis 1.231 0.000
Breast cancer 3.100 0.022
ovarian cancer 1.300 0.038

Synonym

Accession Q7L9L4 B2R8U6 B4DRY3 Q8IY23
Symbols MATS2
MOB4A
MOBKL1A

Gene

Gene RIF (2)

PMID Text
22454515 Mob1A and Mob1B are needed for cell abscission and centriole re-joining after telophase and cytokinesis.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM      1 - 70
LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF     71 - 140
PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK    141 - 210
LTSKDR                                                                    211 - 216
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
22863277 2012 Regulation of the Hippo-YAP pathway by G-protein-coupled receptor signaling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22454515 2012 Human Mob1 proteins are required for cytokinesis by controlling microtubule stability.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19739119 2010 Molecular characterization of human homologs of yeast MOB1.
18328708 2008 MOBKL1A/MOBKL1B phosphorylation by MST1 and MST2 inhibits cell proliferation.
More...