Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.02
PubTator Score 2.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.231 3.2e-06
Breast cancer 3.100 2.2e-02
ependymoma 1.100 2.0e-06
medulloblastoma, large-cell -1.400 1.7e-03
osteosarcoma -1.969 5.8e-05
ovarian cancer 1.300 3.8e-02
Rheumatoid arthritis 1.300 1.7e-02

Protein-protein Interaction (7)

Gene RIF (2)

AA Sequence

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM      1 - 70
LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF     71 - 140
PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK    141 - 210
LTSKDR                                                                    211 - 216
//

Text Mined References (16)

PMID Year Title