Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.00
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.100 3.1e-04
astrocytic glioma -2.500 1.6e-03
Astrocytoma, Pilocytic -3.200 4.8e-07
atypical teratoid / rhabdoid tumor -2.200 3.9e-03
ependymoma -2.600 3.0e-03
glioblastoma -3.100 1.2e-10
interstitial cystitis -1.200 4.6e-03
lung carcinoma 2.100 1.2e-13
oligodendroglioma -2.400 3.7e-03
ovarian cancer -1.100 7.4e-04
primitive neuroectodermal tumor -2.500 3.5e-03
psoriasis -2.700 2.0e-44

Protein-protein Interaction (10)

Gene RIF (8)

AA Sequence

MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLK      1 - 70
SVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENK     71 - 140
IVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKH    141 - 210
LNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNL    211 - 280
SYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVL    281 - 350
SINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL    351 - 420
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAG    421 - 490
NDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCFTFLGVVLFCF    491 - 560
LLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI                            561 - 606
//

Text Mined References (21)

PMID Year Title