Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.67
PubTator Score 10.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 2.03450460891503E-44
lung carcinoma 2844 1.1855467868534E-13
posterior fossa group A ependymoma 1511 1.26881072730584E-11
pilocytic astrocytoma 3086 5.49231696204048E-7
pediatric high grade glioma 2712 4.34799134445579E-6
glioblastoma 5572 9.47241826556548E-6
interstitial cystitis 2299 4.8567572040651E-4
ovarian cancer 8492 7.41551400891267E-4
astrocytic glioma 2241 0.00163681941425837
primitive neuroectodermal tumor 3031 0.003538351782787
oligodendroglioma 2849 0.00372184671841757
atypical teratoid / rhabdoid tumor 4369 0.0039412501874575
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
substance-related disorder 105 0.0 2.0
Disease Target Count Z-score Confidence
Essential tremor 30 4.639 2.3

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.500 0.002
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -2.400 0.004
glioblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -2.200 0.004
primitive neuroectodermal tumor -2.500 0.004
interstitial cystitis -1.300 0.000
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -3.200 0.000
lung carcinoma 2.100 0.000
ovarian cancer -1.100 0.001
psoriasis -2.700 0.000

Synonym

Accession Q7L985 A8K4K7 B2RPM5 Q6ZMD0
Symbols LERN3
LRRN6C

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (8)

PMID Text
25711307 Data indicate that rs10968576, an intronic single nucleotide polymorphism (SNP) within the leucine rich repeat and Ig domain containing 2 LINGO2 (LERN3, LRRN6C) gene was associated with body mass in elderly Swedes at age 70.
22123311 The results of this study concluded that the LINGO-2 variant rs109668280 does not contribute to the risk of developing parkinson disreas in Taiwan.
21287203 demonstrated for the first time that rs7033345 is associated with PD and ET and rs10812774 with ET among Asians, suggesting that LINGO2 might act as a susceptibility gene for essential tremor and Parkinson's disease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20369371 LINGO1 and LINGO2 variants are associated with essential tremor and Parkinson disease
20369371 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLK      1 - 70
SVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENK     71 - 140
IVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKH    141 - 210
LNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNL    211 - 280
SYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVL    281 - 350
SINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL    351 - 420
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAG    421 - 490
NDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCFTFLGVVLFCF    491 - 560
LLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI                            561 - 606
//

Text Mined References (21)

PMID Year Title
25711307 2015 Association of the LINGO2-related SNP rs10968576 with body mass in a cohort of elderly Swedes.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24390345 2014 Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.
24096698 2014 Genome-wide association study of endometrial cancer in E2C2.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22123311 2012 LINGO-2 polymorphism and the risk of Parkinson's disease in Taiwan.
21287203 2011 Lingo2 variants associated with essential tremor and Parkinson's disease.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
More...