Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.08
PubTator Score 3.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma 1.099 3.4e-04
Breast cancer 3.000 2.8e-02
ependymoma 1.100 4.6e-07
group 3 medulloblastoma 2.100 1.3e-04
ovarian cancer 1.100 1.8e-02
primary pancreatic ductal adenocarcinoma 1.065 4.7e-03
primitive neuroectodermal tumor 1.300 7.7e-04

Gene RIF (3)

AA Sequence

MDSVAFEDVAVNFTLEEWALLDPSQKNLYRDVMRETFRNLASVGKQWEDQNIEDPFKIPRRNISHIPERL      1 - 70
CESKEGGQGEETFSQIPDGILNKKTPGVKPCESSVCGEVGMGPSSLNRHIRDHTGREPNEYQEYGKKSYT     71 - 140
RNQCGRALSYHRSFPVRERTHPGGKPYDCKECGETFISLVSIRRHMLTHRGGVPYKCKVCGKAFDYPSLF    141 - 210
RIHERSHTGEKPYECKQCGKAFSCSSYIRIHERTHTGDKPYECKQCGKAFSCSKYIRIHERTHTGEKPYE    211 - 280
CKQCGKAFRCASSVRSHERTHTGEKLFECKECGKALTCLASVRRHMIKHTGNGPYKCKVCGKAFDFPSSF    281 - 350
RIHERTHTGEKPYDCKQCGKAFSCSSSFRKHERIHTGEKPYKCTKCGKAFSRSSYFRIHERTHTGEKPYE    351 - 420
CKQCGKAFSRSTYFRVHEKIHTGEKPYENPNPNASVVPVLS                                 421 - 461
//

Text Mined References (10)

PMID Year Title