Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.87
PubTator Score 3.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (3)

PMID Text
19709766 Observational study of gene-disease association. (HuGE Navigator)
18077766 Observational study of gene-disease association. (HuGE Navigator)
17967605 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDSVAFEDVAVNFTLEEWALLDPSQKNLYRDVMRETFRNLASVGKQWEDQNIEDPFKIPRRNISHIPERL      1 - 70
CESKEGGQGEETFSQIPDGILNKKTPGVKPCESSVCGEVGMGPSSLNRHIRDHTGREPNEYQEYGKKSYT     71 - 140
RNQCGRALSYHRSFPVRERTHPGGKPYDCKECGETFISLVSIRRHMLTHRGGVPYKCKVCGKAFDYPSLF    141 - 210
RIHERSHTGEKPYECKQCGKAFSCSSYIRIHERTHTGDKPYECKQCGKAFSCSKYIRIHERTHTGEKPYE    211 - 280
CKQCGKAFRCASSVRSHERTHTGEKLFECKECGKALTCLASVRRHMIKHTGNGPYKCKVCGKAFDFPSSF    281 - 350
RIHERTHTGEKPYDCKQCGKAFSCSSSFRKHERIHTGEKPYKCTKCGKAFSRSSYFRIHERTHTGEKPYE    351 - 420
CKQCGKAFSRSTYFRVHEKIHTGEKPYENPNPNASVVPVLS                                 421 - 461
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19709766 2011 Variations of specific non-candidate genes and risk of myocardial infarction: a replication study.
18077766 2008 Genetic risk for myocardial infarction determined by polymorphisms of candidate genes in a Japanese population.
17967605 2007 Associations with myocardial infarction of six polymorphisms selected from a three-stage genome-wide association study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12016960 1998 [Isolation of novel expression sequences of C2H2 type zinc finger protein gene from human brain tissue according to the conservation of zinc finger motif].