Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.27
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.300 5.1e-06
Astrocytoma, Pilocytic 1.600 3.0e-10
atypical teratoid / rhabdoid tumor 1.900 2.8e-08
ependymoma 1.900 3.4e-18
glioblastoma 1.500 2.9e-11
lung carcinoma 1.200 2.0e-23
medulloblastoma 1.100 1.8e-05
medulloblastoma, large-cell 1.900 4.0e-05
primitive neuroectodermal tumor 1.100 2.5e-04

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLY      1 - 70
RRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAY     71 - 140
LWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTL    141 - 210
DCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF                 211 - 267
//

Text Mined References (12)

PMID Year Title