Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
tuberculosis and treatment for 6 months 686 3.18109855988901E-6
osteosarcoma 7933 3.3867246160885E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.025732725613826
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0375936388738815

Expression

Synonym

Accession Q7L8L6 Q96JN3 Q9H5D1 Q9H8Y3
Symbols dJ1187M17.5

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

 IMPC Term (1)

Pathway (1)

AA Sequence

MAATLKSLKLVRYRAFCSPSAFGAVRSVSYWNVSSTQHGGQDPPEHISLCHSAKKVKNICSTFSSRRILT      1 - 70
TSSAHPGLEFSKTSSSKASTLQLGSPRATGVDEEDVEVFDSFENMRVFLQLRPEYRVHSYNASETSQLLS     71 - 140
VSEGELILHKVRVNQNNLQAQVIVDYLCKLSSLPAEQHPVLLGSTSFALLCQLSVKKIQLFDTQDLINVL    141 - 210
KAFVILGIPHSHSMLDVYETKCCHQVWEMNMDQLLLVADLWRYLGRKVPRFLNIFSSYLNLHWKDLSLSQ    211 - 280
LVHLIYVIGENRQVSQDLMQKLESLILKYIDLINLEEVGTICLGFFKSSTNLSEFVMRKIGDLACANIQH    281 - 350
LSSRSLVNIVKMFRFTHVDHINFMKQIGEIAPQRIPSLGVQGVMHLTLYCSALRFLNEGVMNAVAASLPP    351 - 420
RVAHCRSKDVAKILWSFGTLNYKPPNAEEFYSSLISEIHRKMPEFNQYPEHLPTCLLGLAFLEYFPVELI    421 - 490
DFALSPGFVRLAQERTKFDLLKELYTLDGTVGIECPDYRGNRLSTHLQQEGSELLWYLAEKDMNSKPEFL    491 - 560
ETVFLLETMLGGPQYVKHHMILPHTRSSDLEVQLDVNLKPLPFNREATPAENVAKLRLEHVGVSLTDDLM    561 - 630
NKLLKGKARGHFQGKTESEPGQQPMELENKAAVPLGGFLCNVADKSGAMEMAGLCPAACMQTPRMKLAVQ    631 - 700
FTNRNQYCYGSRDLLGLHNMKRRQLARLGYRVVELSYWEWLPLLKRTRLEKLAFLHEKVFTSAL          701 - 764
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25683715 2015 Mitochondrial RNA Granules Are Centers for Posttranscriptional RNA Processing and Ribosome Biogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
20869947 2010 Fast kinase domain-containing protein 3 is a mitochondrial protein essential for cellular respiration.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...