Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.15
PubTator Score 6.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -4.200 9.3e-08
astrocytic glioma -1.100 1.6e-02
Astrocytoma, Pilocytic -1.600 1.0e-04
atypical teratoid / rhabdoid tumor -1.800 5.2e-06
Breast cancer 2.200 1.5e-03
breast carcinoma 1.500 7.0e-03
ependymoma -1.400 2.2e-03
glioblastoma -1.200 9.9e-05
group 3 medulloblastoma -1.200 4.1e-02
intraductal papillary-mucinous carcinoma... 2.700 6.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
lung cancer 2.500 4.3e-05
lung carcinoma 5.300 7.7e-74
medulloblastoma, large-cell -1.300 1.2e-03
non-small cell lung cancer 1.049 2.2e-05
oligodendroglioma -2.500 1.7e-02
osteosarcoma 1.953 2.8e-02
ovarian cancer 2.000 6.7e-05
pancreatic cancer 1.800 2.1e-02
pancreatic ductal adenocarcinoma liver m... 2.016 4.9e-02
Pick disease -1.900 2.2e-02
pituitary cancer -1.200 5.7e-05

Gene RIF (4)

AA Sequence

MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEP      1 - 70
VQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVE     71 - 140
DVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQT    141 - 210
ALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTS    211 - 280
AKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKH    281 - 350
KINPVWNEMIMFELPDDLLQASSVELEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAM    351 - 420
WHQLHL                                                                    421 - 426
//

Text Mined References (17)

PMID Year Title