Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.86
PubTator Score 6.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of synaptotagmin XIII (SYT13) in U-937 macrophages
20840848 These studies combine to suggest that SYT13 is a liver tumor suppressor gene and that its function may be mediated through pathways implicated in mesenchymal to epithelial transition
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18202767 human SYT13 functions as a liver tumor suppressor gene that complements a molecular defect in rat liver tumor cells resulting in a normalized cellular phenotype in vitro and suppression of tumorigenicity in vivo

AA Sequence

MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEP      1 - 70
VQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVE     71 - 140
DVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQT    141 - 210
ALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTS    211 - 280
AKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKH    281 - 350
KINPVWNEMIMFELPDDLLQASSVELEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAM    351 - 420
WHQLHL                                                                    421 - 426
//

Text Mined References (17)

PMID Year Title
20840848 2010 Exogenous expression of synaptotagmin XIII suppresses the neoplastic phenotype of a rat liver tumor cell line through molecular pathways related to mesenchymal to epithelial transition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18202767 2008 Re-expression of tumorigenicity after attenuation of human synaptotagmin 13 in a suppressed microcell hybrid cell line.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...