Property Summary

NCBI Gene PubMed Count 49
PubMed Score 88.76
PubTator Score 49.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Substance abuse 55 3.061 1.5
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.730 0.000

Synonym

Accession Q7L8A9 Q96H02 Q9UBF4 Q9Y629
Symbols KIAA1036

Gene

Gene RIF (37)

PMID Text
26460696 VASH1 exerts an antitumor effect on ovarian cancer by inhibiting angiogenesis in the tumor environment
25843115 VASH1 expression levels in atheroma reflects both enhanced neovascularization and the inflammatory burden
25797264 Knockdown of VASH1 in cancer cells promoted cell growth, adhesion and migration in vitro, and enhanced tumorigenesis and metastasis in vivo.
25275025 Overexpression of VASH1 in CRC cells increased malignant potential and promoted metastasis.
25184477 VASH1 and VASH2 showed distinctive localization and opposing function on the fetoplacental vascularization.
25145408 These results suggest that the renal levels of VASH-1 may be affected by local inflammation, crescentic lesions and VEGFR-2.
24748406 High VASH1 expression is associated with non-small cell lung cancer.
24444468 Vasohibin 1/CD34 could identify the proliferative vessels and could be a useful biomarker for predicting the clinical outcome of hepatocellular carcinoma patients.
24390792 We found that vasohibin-1 and VEGF are up-regulated, in mesentery and liver, in cirrhotic and precirrhotic portal hypertensive rats and cirrhosis patients.
24366689 High Vasohibin-1 expression is associated with colorectal cancer.
More...

AA Sequence

MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVD      1 - 70
EATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQ     71 - 140
FFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVN    141 - 210
FAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVL    211 - 280
DVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTS    281 - 350
EPKAMPDLNGYQIRV                                                           351 - 365
//

Text Mined References (50)

PMID Year Title
26460696 2015 The angiogenesis regulator vasohibin-1 inhibits ovarian cancer growth and peritoneal dissemination and prolongs host survival.
25843115 2015 Expression of Vasohibin-1 in Human Carotid Atherosclerotic Plaque.
25797264 2015 Vasohibin-1 suppresses colon cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25275025 2014 Vasohibin-1 increases the malignant potential of colorectal cancer and is a biomarker of poor prognosis.
25184477 2014 Role of the vasohibin family in the regulation of fetoplacental vascularization and syncytiotrophoblast formation.
25145408 2014 Renal distribution of Vasohibin-1 in patients with chronic kidney disease.
24748406 2014 Vasohibin-1 expression detected by immunohistochemistry correlates with prognosis in non-small cell lung cancer.
24444468 2014 The prognostic significance of vasohibin 1-associated angiogenesis in patients with hepatocellular carcinoma.
24390792 2014 Disruption of negative feedback loop between vasohibin-1 and vascular endothelial growth factor decreases portal pressure, angiogenesis, and fibrosis in cirrhotic rats.
More...