Property Summary

NCBI Gene PubMed Count 59
PubMed Score 100.32
PubTator Score 49.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.7e-06
Disease Target Count Z-score Confidence
Substance abuse 59 3.151 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.730 2.7e-06

Gene RIF (47)

AA Sequence

MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVD      1 - 70
EATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQ     71 - 140
FFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVN    141 - 210
FAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVL    211 - 280
DVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTS    281 - 350
EPKAMPDLNGYQIRV                                                           351 - 365
//

Text Mined References (60)

PMID Year Title