Property Summary

NCBI Gene PubMed Count 37
PubMed Score 10.05
PubTator Score 8.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia 1.300 2.7e-02
adult high grade glioma -1.500 4.8e-04
atypical teratoid / rhabdoid tumor -1.500 7.5e-06
Breast cancer 3.000 2.3e-02
ependymoma -1.200 1.1e-05
gastric carcinoma -1.500 2.4e-02
glioblastoma -1.300 6.4e-06
group 4 medulloblastoma -1.500 1.7e-03
lung cancer 2.500 3.5e-03
non-small cell lung cancer -1.094 4.0e-16
osteosarcoma -1.105 1.7e-03
ovarian cancer -1.500 5.4e-05
primitive neuroectodermal tumor -1.100 2.5e-04

Gene RIF (12)

AA Sequence

MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVWKEEASFELPG      1 - 70
LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWFRLESKQGKRIKNRGEIKVNI     71 - 140
QFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTFSDTSSAIIPSTHMPDANSEFSSGEIQMKSK    141 - 210
PKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDT    211 - 280
SKMNQPDSIVDEGELCFGRQNDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENK    281 - 350
REKREKVSLFERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPS    351 - 420
SSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVME    421 - 490
ETPSILRVPYEPSRKAGKFSNS                                                    491 - 512
//

Text Mined References (39)

PMID Year Title