Property Summary

NCBI Gene PubMed Count 35
PubMed Score 9.90
PubTator Score 8.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 3.95261488737817E-16
ovarian cancer 8492 2.52343712851416E-6
medulloblastoma 1524 4.24910513254151E-6
atypical teratoid / rhabdoid tumor 4369 5.77254507625116E-6
posterior fossa group B ependymoma 1530 1.40518209446289E-5
glioblastoma 5572 1.69274192107995E-5
adult high grade glioma 2148 3.91654750525053E-5
primitive neuroectodermal tumor 3031 1.43495604070711E-4
osteosarcoma 7933 0.00171538774866529
lung cancer 4473 0.00349987383396553
gastric carcinoma 832 0.0140945954076253
Breast cancer 3099 0.0226493960636325
acute myeloid leukemia 785 0.0272704425223928

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.800 0.000
osteosarcoma -1.105 0.002
posterior fossa group B ependymoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.800 0.000
primitive neuroectodermal tumor -1.200 0.000
non-small cell lung cancer -1.094 0.000
lung cancer 2.500 0.003
Breast cancer 3.000 0.023
adult high grade glioma -1.600 0.000
gastric carcinoma -1.600 0.014
acute myeloid leukemia 1.300 0.027
ovarian cancer -2.300 0.000

Synonym

Accession Q7L804 A6NEI4 Q3I768 Q9Y2F0 Rab11-FIP2
Symbols nRip11
Rab11-FIP2

Gene

PDB

2GZD   2GZH   4C4P   3TSO   2K6S  

  Ortholog (13)

Gene RIF (10)

PMID Text
26792722 Our data suggested a potential role of Rab11-FIP2 in tumor progression and provided novel insights into the mechanism of how Rab11-FIP2 positively regulated cell migration and invasion in CRC cells.
26502090 our findings reveal a novel mechanism underlying the role of Rab11-FIP2 in gastric cancer dissemination
24372966 Rab11-FIP2 binding to MYO5B is essential for vesicular trafficking in Hela and MDCK cells.
23006599 The recruitment of FIP2 is specific since other members of the Rab11-Family of Interacting Proteins do not associate with the chlamydial inclusions.
22420646 Rab11A/myosin Vb/Rab11-FIP2 complex frames two late recycling steps of langerin from the ERC to the plasma membrane
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18621683 the FIP2 C2 mutant caused a failure at the final budding step in the RSV virus life cycle
17626244 Rab11-FIP2 regulates trafficking at multiple points within the apical recycling system of polarized cells
16775013 Phosphorylation of Rab11-FIP2 on serine 227 by MARK2 regulates an alternative pathway modulating the establishment of epithelial polarity
11994279 Rab11-FIP2 functions downstream of Rab11 in endosomal trafficking.

AA Sequence

MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVWKEEASFELPG      1 - 70
LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWFRLESKQGKRIKNRGEIKVNI     71 - 140
QFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTFSDTSSAIIPSTHMPDANSEFSSGEIQMKSK    141 - 210
PKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDT    211 - 280
SKMNQPDSIVDEGELCFGRQNDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENK    281 - 350
REKREKVSLFERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPS    351 - 420
SSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVME    421 - 490
ETPSILRVPYEPSRKAGKFSNS                                                    491 - 512
//

Text Mined References (37)

PMID Year Title
26792722 2016 Rab11-FIP2 promotes colorectal cancer migration and invasion by regulating PI3K/AKT/MMP7 signaling pathway.
26502090 2016 Rab11-FIP2 promotes the metastasis of gastric cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24824216 2014 Genome-wide interaction studies reveal sex-specific asthma risk alleles.
24372966 2014 Rab11-FIP2 interaction with MYO5B regulates movement of Rab11a-containing recycling vesicles.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006599 2013 Rab11-family of interacting protein 2 associates with chlamydial inclusions through its Rab-binding domain and promotes bacterial multiplication.
22420646 2012 A Rab11A/myosin Vb/Rab11-FIP2 complex frames two late recycling steps of langerin from the ERC to the plasma membrane.
More...