Property Summary

NCBI Gene PubMed Count 35
Grant Count 19
R01 Count 16
Funding $1,031,684.21
PubMed Score 9.90
PubTator Score 8.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.800 0.000
osteosarcoma -1.105 0.002
posterior fossa group B ependymoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.800 0.000
primitive neuroectodermal tumor -1.200 0.000
non-small cell lung cancer -1.094 0.000
lung cancer 2.500 0.003
Breast cancer 3.000 0.023
adult high grade glioma -1.600 0.000
gastric carcinoma -1.600 0.014
acute myeloid leukemia 1.300 0.027
ovarian cancer -2.300 0.000

Gene RIF (10)

PMID Text
26792722 Our data suggested a potential role of Rab11-FIP2 in tumor progression and provided novel insights into the mechanism of how Rab11-FIP2 positively regulated cell migration and invasion in CRC cells.
26502090 our findings reveal a novel mechanism underlying the role of Rab11-FIP2 in gastric cancer dissemination
24372966 Rab11-FIP2 binding to MYO5B is essential for vesicular trafficking in Hela and MDCK cells.
23006599 The recruitment of FIP2 is specific since other members of the Rab11-Family of Interacting Proteins do not associate with the chlamydial inclusions.
22420646 Rab11A/myosin Vb/Rab11-FIP2 complex frames two late recycling steps of langerin from the ERC to the plasma membrane
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18621683 the FIP2 C2 mutant caused a failure at the final budding step in the RSV virus life cycle
17626244 Rab11-FIP2 regulates trafficking at multiple points within the apical recycling system of polarized cells
16775013 Phosphorylation of Rab11-FIP2 on serine 227 by MARK2 regulates an alternative pathway modulating the establishment of epithelial polarity
11994279 Rab11-FIP2 functions downstream of Rab11 in endosomal trafficking.

AA Sequence

MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVWKEEASFELPG      1 - 70
LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWFRLESKQGKRIKNRGEIKVNI     71 - 140
QFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTFSDTSSAIIPSTHMPDANSEFSSGEIQMKSK    141 - 210
PKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDT    211 - 280
SKMNQPDSIVDEGELCFGRQNDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENK    281 - 350
REKREKVSLFERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPS    351 - 420
SSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVME    421 - 490
ETPSILRVPYEPSRKAGKFSNS                                                    491 - 512
//

Text Mined References (37)

PMID Year Title
26792722 2016 Rab11-FIP2 promotes colorectal cancer migration and invasion by regulating PI3K/AKT/MMP7 signaling pathway.
26502090 2016 Rab11-FIP2 promotes the metastasis of gastric cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24824216 2014 Genome-wide interaction studies reveal sex-specific asthma risk alleles.
24372966 2014 Rab11-FIP2 interaction with MYO5B regulates movement of Rab11a-containing recycling vesicles.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006599 2013 Rab11-family of interacting protein 2 associates with chlamydial inclusions through its Rab-binding domain and promotes bacterial multiplication.
22420646 2012 A Rab11A/myosin Vb/Rab11-FIP2 complex frames two late recycling steps of langerin from the ERC to the plasma membrane.
More...