Property Summary

NCBI Gene PubMed Count 33
Grant Count 12
R01 Count 6
Funding $515,057.09
PubMed Score 33.41
PubTator Score 19.66

Knowledge Summary

Patent (5,037)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (12)

PMID Text
24898139 The TAO1 kinase is required for ensuring the normal congression of chromosomes. Depletion of TAO1 reduces the density of growing interphase and mitotic microtubules in human cells, showing TAO1's role in controlling microtubule dynamics.
23585562 tau is a good substrate for PSK1 and PSK2 phosphorylation with mass spectrometric analysis of phosphorylated tau revealing more than 40 tau residues as targets of these kinases.
22075148 Human TAO1 can phosphorylate and activate human MST2
20162290 Data do not support the notion that Tao1 is a component of the spindle checkpoint.
19904549 the apparent role of the Tao1 kinase in spindle checkpoing signaling might in reality reflect an off-target effect produced by particular Tao1-directed siRNA oligonucleotides on Mad2
19110211 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18216281 Spred1-MARKK binding has no effect on the activity of MARKK; therefore, it does not change microtubule (MT) stability.
18187620 Knockdown of TAO kinase 1 (TAOK1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17900936 It is concluded that human TAO kinase 1 induces apoptosis in SH-SY5Y cells and the kinase domain is essential, but its catalytic activity seems to be dispensable in this case.
17417629 Dual functions of TAO1 in regulating microtubule dynamics and checkpoint signalling may help to coordinate the establishment and monitoring of correct congression of chromosomes, thereby protecting genomic stability in human cells.
More...

AA Sequence

MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKW      1 - 70
QDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLA     71 - 140
YLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWS    141 - 210
LGITCIELAERKPPLFNMNAMSALYHIAQNESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIF    211 - 280
VLRERPETVLIDLIQRTKDAVRELDNLQYRKMKKLLFQEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGS    281 - 350
NQSIPSMSISASSQSSSVNSLPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQ    351 - 420
SPPQVSRHKSHYRNREHFATIRTASLVTRQMQEHEQDSELREQMSGYKRMRRQHQKQLMTLENKLKAEMD    421 - 490
EHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHIQAQQKKELNSFLESQKREYK    491 - 560
LRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLELECRRFKRRMLLGRHNLE    561 - 630
QDLVREELNKRQTQKDLEHAMLLRQHESMQELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRREREL    631 - 700
RRKHVMEVRQQPKSLKSKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQTRKLAI    701 - 770
LAEQYDHSINEMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSL    771 - 840
RRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASGW    841 - 910
SHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQ    911 - 980
GMSRSTSVTSQISNGSHMSYT                                                     981 - 1001
//

Text Mined References (49)

PMID Year Title
24898139 2014 TAO1 kinase maintains chromosomal stability by facilitating proper congression of chromosomes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23585562 2013 Prostate-derived sterile 20-like kinases (PSKs/TAOKs) phosphorylate tau protein and are activated in tangle-bearing neurons in Alzheimer disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22075148 2011 The sterile 20-like kinase Tao-1 controls tissue growth by regulating the Salvador-Warts-Hippo pathway.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...