Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $147,097.75
PubMed Score 9.14
PubTator Score 10.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 0.000
subependymal giant cell astrocytoma 1.521 0.016

Synonym

Gene

 Grant Application (1)

Gene RIF (6)

PMID Text
19161603 DHX32 may play an important role in the development of colorectal cancer and could serve as a novel biomarker for colorectal cancer after additional investigation.
17352256 In peripheral blood lymphocytes, a correlation between DHX32 and c-FLIP short expression was detected in response to different T-cell activation stimuli. Results suggest DHX32 involvement in regulating T-cell response to apoptotic stimuli.
17174952 dysregulated expression of DHX32 might lead to as of yet unknown changes in mitochondrial homeostasis manifested by cytoplasmic redistribution of the molecular chaperon Hsp60
16959245 These results suggest that DHX32 is a putative RNA helicase that might be involved in regulating nuclear and mitochondrial gene expression.
16414036 cloned DHX32 proximal promoter and identified a 218bp fragment containing two potential binding sites for the transcription factor nuclear factor of activated T cells (NF-AT)
12163057 Structural characterization and expression of the DDX32 gene. Expression studies show that DDX32 is widespread but specifically down-regulated in acute lymphoblastic leukemias and might play a role in normal and/or abnormal lymphopoiesis.

AA Sequence

MEEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSRYYKLLKEREDLPIWKEKYS      1 - 70
FMENLLQNQIVIVSGDAKCGKSAQVPQWCAEYCLSIHYQHGGVICTQVHKQTVVQLALRVADEMDVNIGH     71 - 140
EVGYVIPFENCCTNETILRYCTDDMLQREMMSNPFLGSYGVIILDDIHERSIATDVLLGLLKDVLLARPE    141 - 210
LKLIINSSPHLISKLNSYYGNVPVIEVKNKHPVEVVYLSEAQKDSFESILRLIFEIHHSGEKGDIVVFLA    211 - 280
CEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSN    281 - 350
SVRFVIDVGVERRKVYNPRIRANSLVMQPISQSQAEIRKQILGSSSSGKFFCLYTEEFASKDMTPLKPAE    351 - 420
MQEANLTSMVLFMKRIDIAGLGHCDFMNRPAPESLMQALEDLDYLAALDNDGNLSEFGIIMSEFPLDPQL    421 - 490
SKSILASCEFDCVDEVLTIAAMVTAPNCFSHVPHGAEEAALTCWKTFLHPEGDHFTLISIYKAYQDTTLN    491 - 560
SSSEYCVEKWCRDYFLNCSALRMADVIRAELLEIIKRIELPYAEPAFGSKENTLNIKKALLSGYFMQIAR    561 - 630
DVDGSGNYLMLTHKQVAQLHPLSGYSITKKMPEWVLFHKFSISENNYIRITSEISPELFMQLVPQYYFSN    631 - 700
LPPSESKDILQQVVDHLSPVSTMNKEQQMCETCPETEQRCTLQ                               701 - 743
//

Text Mined References (18)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19161603 2009 Up-regulation and clinical relevance of novel helicase homologue DHX32 in colorectal cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17352256 A role for DHX32 in regulating T-cell apoptosis.
17174952 2007 Altered distribution of heat shock protein 60 (Hsp60) with dysregulated expression of DHX32.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16959245 2006 Nuclear and mitochondrial localization of the putative RNA helicase DHX32.
16414036 2005 The activation-induced expression of DHX32 in Jurkat T cells is specific and involves calcium and nuclear factor of activated T cells.
More...