Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.600 1.3e-09
intraductal papillary-mucinous carcinoma... 1.100 9.1e-04
invasive ductal carcinoma 2.500 1.7e-03
lung adenocarcinoma 1.400 1.0e-06
lung cancer 2.000 1.7e-03
non primary Sjogren syndrome sicca 1.200 1.5e-02
non-small cell lung cancer 1.484 8.4e-12
subependymal giant cell astrocytoma -1.194 3.4e-02

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (33)

PMID Year Title