Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.25
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.500 7.7e-04
hepatocellular carcinoma 1.300 2.9e-06
intraductal papillary-mucinous neoplasm ... 1.200 1.4e-02
lung cancer 1.200 2.1e-02
lung carcinoma 1.100 1.3e-18
osteosarcoma -1.334 2.6e-03
ovarian cancer -2.000 3.1e-07
pancreatic cancer 1.100 6.7e-03
Pick disease -1.500 8.1e-06
primary pancreatic ductal adenocarcinoma 1.451 3.4e-03
progressive supranuclear palsy -1.400 5.6e-03

Synonym

Accession Q7L775 O94866 Q9H3L3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MWMTPKRSKMEVDEALVFRPEWTQRYLVVEPPEGDGALCLVCRRLIVATRERDVRRHYEAEHEYYERYVA      1 - 70
DGERAALVERLRQGDLPVASFTPEERAARAGLGLCRLLALKGRGWGEGDFVYQCMEVLLREVLPEHVSVL     71 - 140
QGVDLSPDITRQRILSIDRNLRNQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGPELEVQEDLLT    141 - 210
IINLTHHFSVGALMSAILESLQTAGLSLQRMVGLTTTHTLRMIGENSGLVSYMREKAVSPNCWNVIHYSG    211 - 280
FLHLELLSSYDVDVNQIINTISEWIVLIKTRGVRRPEFQTLLTESESEHGERVNGRCLNNWLRRGKTLKL    281 - 350
IFSLRKEMEAFLVSVGATTVHFSDKQWLCDFGFLVDIMEHLRELSEELRVSKVFAAAAFDHICTFEVKLN    351 - 420
LFQRHIEEKNLTDFPALREVVDELKQQNKEDEKIFDPDRYQMVICRLQKEFERHFKDLRFIKKDLELFSN    421 - 490
PFNFKPEYAPISVRVELTKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKA    491 - 560
FSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESNP                           561 - 607
//

Text Mined References (12)

PMID Year Title