Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.67
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.934 0.000
group 3 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.400 0.000
adrenocortical carcinoma 1.103 0.009
non-small cell lung cancer 1.274 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.046
psoriasis -1.300 0.000
ovarian cancer 2.200 0.000

Synonym

Accession Q7L622 Q9BVR2 Q9H9E9 Q9NXC0 Q9P2L3
Symbols PHF7B
KIAA1333

Gene

Gene RIF (2)

PMID Text
25593194 Results suggest that G2E3 is a molecular determinant of the DDR and cell survival.
17239372 Cell cycle phase-specific expression and highly regulated subcellular localization of G2E3 suggest a possible role in cell cycle regulation and the cellular response to DNA damage.

AA Sequence

MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIR      1 - 70
KEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRE     71 - 140
SLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAINAGVFFFRCTICNNSDIFQKEMLRMGIHIP    141 - 210
EKDASWELEENAYQELLQHYERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNW    211 - 280
ECLECRGIIYNSGEFQKAKKHVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNVSTLL    281 - 350
IELGFQIKKKTKRLYINKANIWNSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL    351 - 420
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPENTQPILDDVS    421 - 490
DFDVAQIIIRINTATTVADLKSIINECYNYLELIGCLRLITTLSDKYMLVKDILGYHVIQRVHTPFESFK    491 - 560
QGLKTLGVLEKIQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTME    561 - 630
DILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLRLEKEES    631 - 700
SHYIGH                                                                    701 - 706
//

Text Mined References (14)

PMID Year Title
25593194 2015 Screening analysis of ubiquitin ligases reveals G2E3 as a potential target for chemosensitizing cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
18511420 2008 G2E3 is a dual function ubiquitin ligase required for early embryonic development.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17239372 2007 G2E3 is a nucleo-cytoplasmic shuttling protein with DNA damage responsive localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
More...