Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.67
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.103 8.9e-03
group 3 medulloblastoma 1.600 1.7e-05
intraductal papillary-mucinous carcinoma... 1.200 4.6e-02
medulloblastoma, large-cell 1.400 7.7e-06
non-small cell lung cancer 1.274 3.6e-18
osteosarcoma 1.649 1.4e-03
ovarian cancer -1.100 1.2e-04
psoriasis -1.300 3.5e-09

Gene RIF (2)

AA Sequence

MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIR      1 - 70
KEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRE     71 - 140
SLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAINAGVFFFRCTICNNSDIFQKEMLRMGIHIP    141 - 210
EKDASWELEENAYQELLQHYERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNW    211 - 280
ECLECRGIIYNSGEFQKAKKHVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNVSTLL    281 - 350
IELGFQIKKKTKRLYINKANIWNSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL    351 - 420
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPENTQPILDDVS    421 - 490
DFDVAQIIIRINTATTVADLKSIINECYNYLELIGCLRLITTLSDKYMLVKDILGYHVIQRVHTPFESFK    491 - 560
QGLKTLGVLEKIQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTME    561 - 630
DILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLRLEKEES    631 - 700
SHYIGH                                                                    701 - 706
//

Text Mined References (14)

PMID Year Title