Property Summary

NCBI Gene PubMed Count 11
Grant Count 70
R01 Count 28
Funding $39,232,990
PubMed Score 762.63
PubTator Score 17.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7L5Y9 O95285 Q5JB54 Q6ZRD6 Q9BQ11 Q9H9V6 Q9H9Z4 Q9NW84
Symbols EMP
EMLP
GID9
PIG5
HLC-10

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
23566571 Emp expression correlates with erythroblastic island formation and has an important function for bone marrow hematopoiesis.
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells.
16510120 These results suggest that Emp undergoes dynamic rearrangements within the nuclear architecture that are correlated with cell division.

AA Sequence

MAVQESAAQLSMTLKVQEYPTLKVPYETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSGCPAVDSVVSL      1 - 70
LDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYN     71 - 140
TAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKMKSCLEFSLRIQEFIELIR    141 - 210
QNKRLDAVRHARKHFSQAEGSQLDEVRQAMGMLAFPPDTHISPYKDLLDPARWRMLIQQFRYDNYRLHQL    211 - 280
GNNSVFTLTLQAGLSAIKTPQCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNEN    281 - 350
NPPMMLPNGYVYGYNSLLSIRQDDKVVCPRTKEVFHFSQAEKVYIM                            351 - 396
//

Text Mined References (14)

PMID Year Title
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23566571 2013 Evaluation of erythroblast macrophage protein related to erythroblastic islands in patients with hematopoietic stem cell transplantation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22456796 2012 A single-nucleotide polymorphism in ANK1 is associated with susceptibility to type 2 diabetes in Japanese populations.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17467196 2007 RanBPM, Muskelin, p48EMLP, p44CTLH, and the armadillo-repeat proteins ARMC8alpha and ARMC8beta are components of the CTLH complex.
16510120 2006 Emp is a component of the nuclear matrix of mammalian cells and undergoes dynamic rearrangements during cell division.
More...