Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.98
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVN      1 - 70
ALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVD     71 - 140
MDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQ    141 - 210
ALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTS    211 - 280
PDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEI    281 - 350
PVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKE    351 - 420
ESVKKHQYPDGEVWKKLLPAQEN                                                   421 - 443
//

Text Mined References (26)

PMID Year Title