Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $134,803.75
PubMed Score 6.83
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25677901 The suitability of the present method for gastric serum proteomic analysis was demonstrated and led to the identification of two peptide regions the expression of the SERPINA1 and ENOSF1
24697329 A reverse thymidylate synthase gamma is an l-fuconate dehydratase and its high-resolution crystal structure was determined.
24647007 The toxicity polymorphism in the TYMS region may actually act through ENOSF1
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
19190136 Observational study of gene-disease association. (HuGE Navigator)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVN      1 - 70
ALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVD     71 - 140
MDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQ    141 - 210
ALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTS    211 - 280
PDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEI    281 - 350
PVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKE    351 - 420
ESVKKHQYPDGEVWKKLLPAQEN                                                   421 - 443
//

Text Mined References (25)

PMID Year Title
25677901 2015 Identification of peptide regions of SERPINA1 and ENOSF1 and their protein expression as potential serum biomarkers for gastric cancer.
24697329 2014 Enzymatic and structural characterization of rTS? provides insights into the function of rTS?.
24647007 2015 A candidate gene study of capecitabine-related toxicity in colorectal cancer identifies new toxicity variants at DPYD and a putative role for ENOSF1 rather than TYMS.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
19190136 2009 Association of thymidylate synthase gene with endometrial cancer risk in a Chinese population.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
More...