Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.83
PubTator Score 8.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.23007136932714E-13
ovarian cancer 8492 1.07995214562114E-9
tuberculosis 1563 4.4010144028804E-7
malignant mesothelioma 3163 1.98031595645207E-6
Breast cancer 3099 5.0388406100585E-6
pituitary cancer 1972 5.302752016852E-5
atypical teratoid / rhabdoid tumor 4369 9.96451582283433E-5
osteosarcoma 7933 1.22628558485963E-4
cutaneous lupus erythematosus 1056 0.00127065707974453
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00337092227699483
Pick disease 1893 0.00353207937679123
primitive neuroectodermal tumor 3031 0.00410954415112049
sarcoidosis 368 0.0110333096341031
pilocytic astrocytoma 3086 0.0119045375634097
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0139084064992074
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0167636590012672
subependymal giant cell astrocytoma 2287 0.0179842100866832
progressive supranuclear palsy 674 0.0221388088197842
Waldenstrons macroglobulinemia 765 0.0347605469438349
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0426755568486573
Disease Target Count Z-score Confidence
Rothmund-Thomson syndrome 22 4.827 2.4
Pompholyx 4 4.393 2.2

Expression

Synonym

Gene

PANTHER Protein Class (2)

PDB

4A35  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
25677901 The suitability of the present method for gastric serum proteomic analysis was demonstrated and led to the identification of two peptide regions the expression of the SERPINA1 and ENOSF1
24697329 A reverse thymidylate synthase gamma is an l-fuconate dehydratase and its high-resolution crystal structure was determined.
24647007 The toxicity polymorphism in the TYMS region may actually act through ENOSF1
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
19190136 Observational study of gene-disease association. (HuGE Navigator)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVN      1 - 70
ALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVD     71 - 140
MDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQ    141 - 210
ALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTS    211 - 280
PDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEI    281 - 350
PVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKE    351 - 420
ESVKKHQYPDGEVWKKLLPAQEN                                                   421 - 443
//

Text Mined References (25)

PMID Year Title
25677901 2015 Identification of peptide regions of SERPINA1 and ENOSF1 and their protein expression as potential serum biomarkers for gastric cancer.
24697329 2014 Enzymatic and structural characterization of rTS? provides insights into the function of rTS?.
24647007 2015 A candidate gene study of capecitabine-related toxicity in colorectal cancer identifies new toxicity variants at DPYD and a putative role for ENOSF1 rather than TYMS.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
19190136 2009 Association of thymidylate synthase gene with endometrial cancer risk in a Chinese population.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
More...