Property Summary

NCBI Gene PubMed Count 14
PubMed Score 32.66
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.7e-05
Breast cancer 1.100 3.7e-02
breast carcinoma -1.100 5.5e-18
ependymoma -2.000 1.2e-02
group 3 medulloblastoma -1.900 1.9e-03
intraductal papillary-mucinous adenoma (... 1.200 1.3e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.0e-02
invasive ductal carcinoma -1.300 1.5e-02
lung carcinoma -2.200 9.0e-20
medulloblastoma, large-cell -1.500 1.7e-03
oligodendroglioma -1.700 1.1e-02
osteosarcoma -2.458 1.1e-04
ovarian cancer 1.400 3.7e-03
pancreatic cancer 1.100 5.8e-04
tuberculosis 1.400 1.9e-04

 GWAS Trait (1)

Gene RIF (9)

AA Sequence

MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIVLLGIILLPIRV      1 - 70
LLVALILLLAWPFAAISTVCCPEKLTHPITGWRRKITQTALKFLGRAMFFSMGFIVAVKGKIASPLEAPV     71 - 140
FVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRLLRAVQPVLVSRVDPDSRKNTINEIIKRTTSGG    141 - 210
EWPQILVFPEGTCTNRSCLITFKPGAFIPGVPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTK    211 - 280
VEVEFMPVQVPNDEEKNDPVLFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKIS    281 - 350
RKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL    351 - 420
AVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFA    421 - 490
LKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD                    491 - 544
//

Text Mined References (17)

PMID Year Title