Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $246,307.63
PubMed Score 28.70
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -2.000 0.012
oligodendroglioma -1.700 0.011
osteosarcoma -2.458 0.000
group 4 medulloblastoma -2.000 0.000
medulloblastoma, large-cell -1.500 0.002
tuberculosis 3.000 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.001
intraductal papillary-mucinous neoplasm ... 1.300 0.040
pancreatic cancer 1.100 0.001
pilocytic astrocytoma 1.200 0.000
Breast cancer -2.500 0.000
lung carcinoma -2.200 0.000
breast carcinoma -1.100 0.000
invasive ductal carcinoma -1.300 0.015
ovarian cancer 1.400 0.004

Synonym

Accession Q7L5N7 A3KBM1 Q6MZJ6 Q9NX23 LPC acyltransferase 2
Symbols AYTL1
AGPAT11
LysoPAFAT

Gene

 Grant Application (2)

Gene RIF (9)

PMID Text
25411967 three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients.
23844124 Data indicate a strong negative correlation between ALOX15, FADS2, and IL5RA expression with 2-arachidonoylglycerophosphocholine levels in dual asthmatic responses.
21498505 LPCAT1 and -2 have, in addition to their known function in specialized cells, a ubiquitous role in LD-associated lipid metabolism
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363836 Our enzymatic assays strongly suggest that the cDNA previously identified as LPCAT2/lyso platelet-activating factor-acetyltransferase cDNA has AGPAT activity and thus we prefer to identify this clone as AGPAT11 as well.
19913121 Observational study of gene-disease association. (HuGE Navigator)
17182612 The enzyme acetyl-CoA:LYSO-PAF acetyltransferase catalyzes not only biosynthesis of PAF upon acute inflammatory stimulation but also incorporation of arachidonoyl-CoA to produce PAF precursor membrane glycerophospholipids for membrane biogenesis.

AA Sequence

MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIVLLGIILLPIRV      1 - 70
LLVALILLLAWPFAAISTVCCPEKLTHPITGWRRKITQTALKFLGRAMFFSMGFIVAVKGKIASPLEAPV     71 - 140
FVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRLLRAVQPVLVSRVDPDSRKNTINEIIKRTTSGG    141 - 210
EWPQILVFPEGTCTNRSCLITFKPGAFIPGVPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTK    211 - 280
VEVEFMPVQVPNDEEKNDPVLFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKIS    281 - 350
RKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL    351 - 420
AVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFA    421 - 490
LKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD                    491 - 544
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25411967 2014 A systems genetics approach identifies CXCL14, ITGAX, and LPCAT2 as novel aggressive prostate cancer susceptibility genes.
23844124 2013 Gene-metabolite expression in blood can discriminate allergen-induced isolated early from dual asthmatic responses.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
21498505 2011 Human lysophosphatidylcholine acyltransferases 1 and 2 are located in lipid droplets where they catalyze the formation of phosphatidylcholine.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363836 2010 Enzymatic activity of the human 1-acylglycerol-3-phosphate-O-acyltransferase isoform 11: upregulated in breast and cervical cancers.
More...