Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.12
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

AA Sequence

MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLL      1 - 70
ELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQ     71 - 140
RFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLS    141 - 210
YYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLN    211 - 280
EESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS                                    281 - 318
//

Text Mined References (10)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8895530 1996 A pancreatic cancer-specific expression profile.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.