Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.12
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Lipoidosis 19
Disease Target Count P-value
psoriasis 6685 6.86839051444018E-156
osteosarcoma 7933 4.0625207298772E-8
nasopharyngeal carcinoma 1056 2.21540644328023E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 3.43186432086684E-5
interstitial cystitis 2299 1.21371377249847E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.70822082926002E-4
colon cancer 1475 0.00589787745704663
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00647881596277379
Breast cancer 3099 0.0270162221104319

Expression

  Differential Expression (9)

Synonym

Accession Q7L5L3 Q9H652
Symbols GDE7

Gene

PANTHER Protein Class (2)

  Ortholog (8)

AA Sequence

MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLL      1 - 70
ELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQ     71 - 140
RFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLS    141 - 210
YYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLN    211 - 280
EESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS                                    281 - 318
//

Text Mined References (10)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8895530 1996 A pancreatic cancer-specific expression profile.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.