Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.00
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -2.200 2.7e-02
colon cancer -1.900 5.9e-03
interstitial cystitis -1.100 7.6e-03
intraductal papillary-mucinous adenoma (... 1.700 3.4e-05
intraductal papillary-mucinous carcinoma... 1.900 6.5e-03
intraductal papillary-mucinous neoplasm ... 2.400 5.7e-04
nasopharyngeal carcinoma -1.400 2.2e-06
osteosarcoma -2.855 4.1e-08
psoriasis 1.900 3.6e-09

AA Sequence

MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLL      1 - 70
ELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQ     71 - 140
RFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLS    141 - 210
YYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLN    211 - 280
EESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS                                    281 - 318
//

Text Mined References (10)

PMID Year Title