Property Summary

NCBI Gene PubMed Count 20
Grant Count 58
R01 Count 24
Funding $8,802,566.5
PubMed Score 487.61
PubTator Score 32.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25535373 Both TRC35 and Ubl4A have distinct C-terminal binding sites on Bag6 defining a minimal Bag6 complex.
24727835 The crystal structure of the Get3-Get4-Get5 complex in an ATP-bound state is presented.
23723067 Data indicate that BCL2-associated athanogene 6 (BAG6) appears to be the central component for the process, as depletion of BAG6 leads to the loss of both UBL4A and GET4 proteins and resistance to cell killing by DNA-damaging agents.
23665563 Data indicate that the Bag6-Ubl4A-Trc35 complex is localized to the endoplasmic reticulum (ER) membrane to regulate ER-associated degradation (ERAD).
23246001 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.

AA Sequence

MAAAAAMAEQESARNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHTEARELMYSGA      1 - 70
LLFFSHGQQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVSRALKWSSGGSGKL     71 - 140
GHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCANMLVEYSTSRGFRSEVDMFVAQAVLQFLCLKNKS    141 - 210
SASVVFTTYTQKHPSIEDGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIG    211 - 280
QLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD                           281 - 327
//

Text Mined References (27)

PMID Year Title
25535373 2015 Bag6 complex contains a minimal tail-anchor-targeting module and a mock BAG domain.
25416956 2014 A proteome-scale map of the human interactome network.
24727835 2014 Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4.
23723067 2013 Nuclear BAG6-UBL4A-GET4 complex mediates DNA damage signaling and cell death.
23665563 2013 A ubiquitin-like domain recruits an oligomeric chaperone to a retrotranslocation complex in endoplasmic reticulum-associated degradation.
23246001 2012 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21636303 2011 A ubiquitin ligase-associated chaperone holdase maintains polypeptides in soluble states for proteasome degradation.
More...