Property Summary

NCBI Gene PubMed Count 20
PubMed Score 515.20
PubTator Score 32.07

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (5)

AA Sequence

MAAAAAMAEQESARNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHTEARELMYSGA      1 - 70
LLFFSHGQQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVSRALKWSSGGSGKL     71 - 140
GHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCANMLVEYSTSRGFRSEVDMFVAQAVLQFLCLKNKS    141 - 210
SASVVFTTYTQKHPSIEDGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIG    211 - 280
QLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD                           281 - 327
//

Text Mined References (29)

PMID Year Title