Property Summary

NCBI Gene PubMed Count 20
PubMed Score 487.61
PubTator Score 32.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7L5D6 A4D2Q1 B3KNC7 Q9UFC9 Q9Y309
Symbols CEE
TRC35
CGI-20
C7orf20

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25535373 Both TRC35 and Ubl4A have distinct C-terminal binding sites on Bag6 defining a minimal Bag6 complex.
24727835 The crystal structure of the Get3-Get4-Get5 complex in an ATP-bound state is presented.
23723067 Data indicate that BCL2-associated athanogene 6 (BAG6) appears to be the central component for the process, as depletion of BAG6 leads to the loss of both UBL4A and GET4 proteins and resistance to cell killing by DNA-damaging agents.
23665563 Data indicate that the Bag6-Ubl4A-Trc35 complex is localized to the endoplasmic reticulum (ER) membrane to regulate ER-associated degradation (ERAD).
23246001 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.

AA Sequence

MAAAAAMAEQESARNGGRNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHTEARELMYSGA      1 - 70
LLFFSHGQQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVSRALKWSSGGSGKL     71 - 140
GHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCANMLVEYSTSRGFRSEVDMFVAQAVLQFLCLKNKS    141 - 210
SASVVFTTYTQKHPSIEDGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIG    211 - 280
QLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD                           281 - 327
//

Text Mined References (27)

PMID Year Title
25535373 2015 Bag6 complex contains a minimal tail-anchor-targeting module and a mock BAG domain.
25416956 2014 A proteome-scale map of the human interactome network.
24727835 2014 Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4.
23723067 2013 Nuclear BAG6-UBL4A-GET4 complex mediates DNA damage signaling and cell death.
23665563 2013 A ubiquitin-like domain recruits an oligomeric chaperone to a retrotranslocation complex in endoplasmic reticulum-associated degradation.
23246001 2012 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21636303 2011 A ubiquitin ligase-associated chaperone holdase maintains polypeptides in soluble states for proteasome degradation.
More...