Property Summary

NCBI Gene PubMed Count 27
PubMed Score 293.85
PubTator Score 42.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Spastic Paraplegia 35, Autosomal Recessive 1 0.0 0.0
Disease Target Count Z-score Confidence
Hereditary spastic paraplegia 35 5 0.0 5.0

Expression

  Differential Expression (24)

Gene RIF (17)

AA Sequence

MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHS      1 - 70
ANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEK     71 - 140
YDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAV    141 - 210
PKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLV    211 - 280
IGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGI    281 - 350
STKLWDYCFHTLTPEKPHLKTQ                                                    351 - 372
//

Text Mined References (27)

PMID Year Title