Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.48
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.29 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.000 9.6e-07
mucosa-associated lymphoid tissue lympho... 1.219 7.5e-03
ulcerative colitis 1.200 2.5e-04

Synonym

Accession Q7L5A3 B1AML4 B1AML5 D3DRN5 O60377 Q9BQ60 Q9HAI9 Q9P1Y9
Symbols KIAA1539

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRHVQAEPSPSSEPEAGPSQPPVRQGALQGGLLMGYSPAGGATSPGVYQVSIFSPPAGTSEPHRALKRQA      1 - 70
PSTEGPRELKRGPGLGAREGLPPEEPSTVGLLGPEGPGLGLGVASQHFSHRGLCVVEQRSSVTSSWTSGA     71 - 140
WSPPCPPSNASCNTLHTRDWASPDPGGQGSLGESPGPAPPGQLHTLDTDLHSLAQIGGKSPVAGVGNGGS    141 - 210
LWPRESPGTANGHSPEHTPPGPGPPGPCPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDA    211 - 280
KATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARRLKLSPLRSLRKGPGLLSPPSASPVPTPAVSRTLLG    281 - 350
NFEESLLRGRFAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQNAPAPFLGIVDLNPLGRKGYS    351 - 420
VPKVGTVQVTLFNPNQTVVKMFLVTFDFSDMPAAHMTFLRHRLFLVPVGEEGNANPTHRLLCYLLHLRFR    421 - 490
SSRSGRLSLHGDIRLLFSRRSLELDTGLPYELQAVTEAPHNPRYSPLP                          491 - 538
//

Text Mined References (15)

PMID Year Title