Property Summary

NCBI Gene PubMed Count 21
PubMed Score 45.27
PubTator Score 18.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
inflammatory breast cancer 1.100 1.7e-02
interstitial cystitis 2.800 3.4e-04
non-small cell lung cancer -1.426 1.2e-13
osteosarcoma -4.308 2.3e-06
primary Sjogren syndrome 1.900 1.0e-04
subependymal giant cell astrocytoma 1.580 3.0e-02
ulcerative colitis 2.200 1.1e-04

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (7)

AA Sequence

MTRGARLRSDARAQLNQLSLDGGTGSGQKGKCEEFPSSLSSVSPGLEAAALLLAVTMDPLETPIKDGILY      1 - 70
QQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRDGGLGAAGDRSAGPGRRGERRVIRLADCVSVLPAD     71 - 140
GESCPRDTGAFLLTTTERSHLLAAQHRQAWMGPICQLAFPGTGEASSGSTDAQSPKRGLVPMEENSIYSS    141 - 210
WQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQALYSWPYHFLRKFGSDKGVFSFEAGR    211 - 280
RCHSGEGLFAFSTPCAPDLCRAVAGAIARQRERLPELTRPQPCPLPRATSLPSLDTPGELREMPPGPEPP    281 - 350
TSRKMHLAEPGPQSLPLLLGPEPNDLASGLYASVCKRASGPPGNEHLYENLCVLEASPTLHGGEPEPHEG    351 - 420
PGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRERRKGP    421 - 490
APCDRP                                                                    491 - 496
//

Text Mined References (26)

PMID Year Title