Property Summary

NCBI Gene PubMed Count 20
Grant Count 20
R01 Count 10
Funding $1,472,265.31
PubMed Score 44.39
PubTator Score 18.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -4.308 0.000
non-small cell lung cancer -1.426 0.000
interstitial cystitis 2.800 0.000
primary Sjogren syndrome 1.900 0.000
subependymal giant cell astrocytoma 1.580 0.030
inflammatory breast cancer 1.100 0.017
ulcerative colitis 2.200 0.000

Gene RIF (6)

PMID Text
27265473 DOK2 and DOK3 expression was significantly reduced in HTLV-1-infected T cells.
23223229 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters
22761938 absence of DOK3 increases LPS signaling, contributing to LPS-induced tolerance. Thus, DOK3 plays a role in TLR signaling during both naive and endotoxin-induced tolerant conditions
20139980 Identification of DOK genes as lung tumor suppressors.
19682241 The novel platelet adapter Dok-3 is tyrosine phosphorylated in an Src kinase-independent manner downstream of alphaIIbbeta3 in human platelets, leading to an interaction with Grb2 and SHIP-1.
16436051 findings indicate that Dok-3 sequesters Grb2 from Shc and inhibits the Ras-Erk pathway downstream of PTKs

AA Sequence

MTRGARLRSDARAQLNQLSLDGGTGSGQKGKCEEFPSSLSSVSPGLEAAALLLAVTMDPLETPIKDGILY      1 - 70
QQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRDGGLGAAGDRSAGPGRRGERRVIRLADCVSVLPAD     71 - 140
GESCPRDTGAFLLTTTERSHLLAAQHRQAWMGPICQLAFPGTGEASSGSTDAQSPKRGLVPMEENSIYSS    141 - 210
WQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQALYSWPYHFLRKFGSDKGVFSFEAGR    211 - 280
RCHSGEGLFAFSTPCAPDLCRAVAGAIARQRERLPELTRPQPCPLPRATSLPSLDTPGELREMPPGPEPP    281 - 350
TSRKMHLAEPGPQSLPLLLGPEPNDLASGLYASVCKRASGPPGNEHLYENLCVLEASPTLHGGEPEPHEG    351 - 420
PGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRERRKGP    421 - 490
APCDRP                                                                    491 - 496
//

Text Mined References (25)

PMID Year Title
27265473 2016 Expression of DOK1, 2, and 3 genes in HTLV-1-infected T cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23223229 2013 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22761938 2012 DOK3 negatively regulates LPS responses and endotoxin tolerance.
21269460 2011 Initial characterization of the human central proteome.
20139980 2010 Identification of DOK genes as lung tumor suppressors.
More...