Property Summary

NCBI Gene PubMed Count 44
Grant Count 33
R01 Count 29
Funding $3,119,324.93
PubMed Score 49.93
PubTator Score 35.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
26401039 HIV-1 depletes MCM10 in a Vpr-dependent manner
26401039 HIV-1 depletes MCM10 in a Vpr-dependent manner
26032416 MCM10 is the natural substrate of the Cul4-DDB1[VprBP] E3 ubiquitin ligase whose degradation is regulated by VprBP, but Vpr enhances the proteasomal degradation of MCM10 by interacting with VprBP.
26032416 HIV-1 depletes MCM10 in a Vpr-dependent manner
26032416 HIV-1 depletes MCM10 in a Vpr-dependent manner
26032416 HIV-1 depletes MCM10 in a Vpr-dependent manner
25602958 RecQL4-dependent association of Mcm10 and Ctf4 with replication origins appears to be the first important step controlled by S phase promoting kinases and checkpoint pathways for the initiation of DNA replication in human cells.
24662891 Loss of Mcm10 engages checkpoint, DNA repair and SUMO-dependent rescue pathways that collectively counteract replication stress and chromosome breakage. [Review]
23750504 Data suggest that CDC45 and MCM10 (minichromosome maintenance complex component 10) directly interact and establish a mutual co-operation in DNA binding; key domains appear to interact and then interact with DNA inside cells or in cell-free systems.
23449222 This report shows that human Mcm10 is an acetylated protein regulated by SIRT1, which binds and deacetylates Mcm10 both in vivo and in vitro, and modulates Mcm10 stability and ability to bind DNA.
More...

AA Sequence

MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEADDGETGETRDE      1 - 70
KENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELRNLQEQMKALQEQLKVTTIKQ     71 - 140
TASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDVPALPRTKRVARTPKASPPDPKSSSSRMTSA    141 - 210
PSQPLQTISRNKPSGITRGQIVGTPGSSGETTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQI    211 - 280
KEKMAREKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTV    281 - 350
VGILNANPMKPKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQY    351 - 420
KKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPKKKIQTTLSNL    421 - 490
VVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASA    491 - 560
LLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSSRQPPAQPPRTGSEFPRLEGAPATMTPKLGR    561 - 630
GVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEK    631 - 700
NTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKM    701 - 770
RNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYK    771 - 840
WERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK                                       841 - 875
//

Text Mined References (48)

PMID Year Title
26032416 2015 HIV-1 Vpr Protein Enhances Proteasomal Degradation of MCM10 DNA Replication Factor through the Cul4-DDB1[VprBP] E3 Ubiquitin Ligase to Induce G2/M Cell Cycle Arrest.
25602958 2015 RecQL4 is required for the association of Mcm10 and Ctf4 with replication origins in human cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24726359 2014 The RBBP6/ZBTB38/MCM10 axis regulates DNA replication and common fragile site stability.
24662891 2014 MCM10: one tool for all-Integrity, maintenance and damage control.
23750504 2013 The physical interaction of Mcm10 with Cdc45 modulates their DNA-binding properties.
23449222 2013 Human SIRT1 regulates DNA binding and stability of the Mcm10 DNA replication factor via deacetylation.
22918587 2012 Structural biology of replication initiation factor Mcm10.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...