Property Summary

NCBI Gene PubMed Count 45
PubMed Score 55.09
PubTator Score 35.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 1.354 9.6e-03
adult high grade glioma 1.500 4.0e-04
Atopic dermatitis 1.400 1.0e-03
atypical teratoid / rhabdoid tumor 3.000 7.3e-12
Breast cancer 2.200 1.2e-08
breast carcinoma 1.200 4.9e-20
ductal carcinoma in situ 1.100 3.3e-02
ependymoma 1.100 5.9e-05
glioblastoma 2.500 1.3e-07
group 3 medulloblastoma 3.700 6.0e-08
intraductal papillary-mucinous carcinoma... 1.200 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.6e-03
invasive ductal carcinoma 2.900 1.9e-03
lung adenocarcinoma 1.100 1.8e-12
lung cancer 2.000 4.5e-03
malignant mesothelioma 1.600 3.2e-07
medulloblastoma, large-cell 4.000 2.4e-08
nasopharyngeal carcinoma 1.200 5.9e-04
non-small cell lung cancer 2.567 2.8e-23
osteosarcoma -1.480 1.3e-02
ovarian cancer 1.900 1.3e-05
primitive neuroectodermal tumor 3.200 3.0e-05
psoriasis 1.100 2.0e-02
ulcerative colitis 1.200 3.3e-05

Protein-protein Interaction (4)

Gene RIF (27)

AA Sequence

MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEADDGETGETRDE      1 - 70
KENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELRNLQEQMKALQEQLKVTTIKQ     71 - 140
TASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDVPALPRTKRVARTPKASPPDPKSSSSRMTSA    141 - 210
PSQPLQTISRNKPSGITRGQIVGTPGSSGETTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQI    211 - 280
KEKMAREKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTV    281 - 350
VGILNANPMKPKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQY    351 - 420
KKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPKKKIQTTLSNL    421 - 490
VVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASA    491 - 560
LLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSSRQPPAQPPRTGSEFPRLEGAPATMTPKLGR    561 - 630
GVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEK    631 - 700
NTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKM    701 - 770
RNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYK    771 - 840
WERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK                                       841 - 875
//

Text Mined References (50)

PMID Year Title