Property Summary

NCBI Gene PubMed Count 44
PubMed Score 49.93
PubTator Score 35.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.68969557160644E-125
non-small cell lung cancer 2798 2.75381472289316E-23
breast carcinoma 1614 4.91598178573726E-20
lung adenocarcinoma 2714 1.84572296723045E-12
atypical teratoid / rhabdoid tumor 4369 7.2552025876546E-12
Breast cancer 3099 1.22195709406871E-8
medulloblastoma, large-cell 6234 2.35271309168124E-8
group 3 medulloblastoma 2254 5.96382291980584E-8
pediatric high grade glioma 2712 1.01646958446561E-7
malignant mesothelioma 3163 3.22679191486636E-7
glioblastoma 5572 2.46426000873605E-6
lung cancer 4473 3.03028772105103E-6
ovarian cancer 8492 1.2584011389808E-5
primitive neuroectodermal tumor 3031 2.99624460884445E-5
ulcerative colitis 2087 3.32181752367818E-5
posterior fossa group A ependymoma 1511 6.88774077380617E-5
nasopharyngeal carcinoma 1056 5.91577623255925E-4
Atopic dermatitis 944 9.99366032394831E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00144628067546722
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00164251181211807
invasive ductal carcinoma 2950 0.00193850983650993
adrenocortical carcinoma 1427 0.00962799908820395
osteosarcoma 7933 0.0129803049160289
ductal carcinoma in situ 1745 0.0327245869886953
Disease Target Count Z-score Confidence
Rothmund-Thomson syndrome 22 3.42 1.7

Expression

Synonym

Accession Q7L590 A8K9I6 B7ZKZ8 Q3MIR3 Q7LD55 Q96GX4 Q96NB6 Q9H0D7 Q9H3P9 Q9P177 HsMCM10
Symbols CNA43
DNA43
PRO2249

Gene

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (26)

PMID Text
26401039 HIV-1 depletes MCM10 in a Vpr-dependent manner
26032416 MCM10 is the natural substrate of the Cul4-DDB1[VprBP] E3 ubiquitin ligase whose degradation is regulated by VprBP, but Vpr enhances the proteasomal degradation of MCM10 by interacting with VprBP.
26032416 HIV-1 depletes MCM10 in a Vpr-dependent manner
25602958 RecQL4-dependent association of Mcm10 and Ctf4 with replication origins appears to be the first important step controlled by S phase promoting kinases and checkpoint pathways for the initiation of DNA replication in human cells.
24662891 Loss of Mcm10 engages checkpoint, DNA repair and SUMO-dependent rescue pathways that collectively counteract replication stress and chromosome breakage. [Review]
23750504 Data suggest that CDC45 and MCM10 (minichromosome maintenance complex component 10) directly interact and establish a mutual co-operation in DNA binding; key domains appear to interact and then interact with DNA inside cells or in cell-free systems.
23449222 This report shows that human Mcm10 is an acetylated protein regulated by SIRT1, which binds and deacetylates Mcm10 both in vivo and in vitro, and modulates Mcm10 stability and ability to bind DNA.
22918587 Mcm10 utilizes a modular architecture to act as a replisome scaffold, which helps to define possible roles in origin DNA melting, Pol alpha recruitment and coordination of enzymatic activities during elongation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20064936 High doses of ionizing gamma radiation and exposure to a combination of DNA-damaging chemicals do not decrease Mcm10 protein levels, demonstrating that Mcm10 down-regulation is triggered only by UV-specific damage
More...

AA Sequence

MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEADDGETGETRDE      1 - 70
KENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELRNLQEQMKALQEQLKVTTIKQ     71 - 140
TASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDVPALPRTKRVARTPKASPPDPKSSSSRMTSA    141 - 210
PSQPLQTISRNKPSGITRGQIVGTPGSSGETTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQI    211 - 280
KEKMAREKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTV    281 - 350
VGILNANPMKPKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQY    351 - 420
KKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPKKKIQTTLSNL    421 - 490
VVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASA    491 - 560
LLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSSRQPPAQPPRTGSEFPRLEGAPATMTPKLGR    561 - 630
GVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEK    631 - 700
NTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKM    701 - 770
RNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYK    771 - 840
WERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK                                       841 - 875
//

Text Mined References (48)

PMID Year Title
26032416 2015 HIV-1 Vpr Protein Enhances Proteasomal Degradation of MCM10 DNA Replication Factor through the Cul4-DDB1[VprBP] E3 Ubiquitin Ligase to Induce G2/M Cell Cycle Arrest.
25602958 2015 RecQL4 is required for the association of Mcm10 and Ctf4 with replication origins in human cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24726359 2014 The RBBP6/ZBTB38/MCM10 axis regulates DNA replication and common fragile site stability.
24662891 2014 MCM10: one tool for all-Integrity, maintenance and damage control.
23750504 2013 The physical interaction of Mcm10 with Cdc45 modulates their DNA-binding properties.
23449222 2013 Human SIRT1 regulates DNA binding and stability of the Mcm10 DNA replication factor via deacetylation.
22918587 2012 Structural biology of replication initiation factor Mcm10.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...