Property Summary

NCBI Gene PubMed Count 35
Grant Count 14
R01 Count 11
Funding $827,492.15
PubMed Score 26.70
PubTator Score 20.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (12)

PMID Text
26843638 Hippocampal synapses with reduced Cyfip1 are larger and release neurotransmitter more rapidly.
26824476 Reduced CYFIP1 in human neural progenitors results in dysregulation of schizophrenia and epilepsy gene networks.
25311365 Data confirm that CYFIP1 is upregulated in transformed lymphoblastoid cell lines and demonstrate its upregulation in the post-mortem brain from 15q11-13 duplication patients for the first time
25048004 This study confirmed that CYFIP2 were altered in postsynaptic density in patient with schizophrenia.
24996170 haploinsufficiency causes cell polarity defects via WAVE complex destabilization; genetic polymorphism is associated with schizophrenia
24442360 An imbalance of specific isoforms of CYFIP1, an FMRP interaction partner, and CAMK4, a transcriptional regulator of the FMRP gene, modulates risk for autism spectrum disorders.
20298200 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20228810 Protein complexes containing CYFIP/Sra/PIR121 coordinate Arf1 and Rac1 signalling during clathrin-AP-1-coated carrier biogenesis at the trans-golgi network.
19524508 Study found that Cyfip1, a subunit of the WAVE complex, which regulates cytoskeletal dynamics, is commonly deleted in human epithelial cancers.
16982806 quantitated mRNA levels of NIPA2, NIPA2,l CYFIP1, and GCP5 in Prader-Willi syndrome and correlated levels with psychological and behavior scales
More...

AA Sequence

MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMN      1 - 70
EMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEV     71 - 140
RRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNL    141 - 210
SMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSN    211 - 280
IYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMI    281 - 350
QIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT    351 - 420
DKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQV    421 - 490
TLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLY    491 - 560
MVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLEL    561 - 630
TMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFD    631 - 700
QFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQ    701 - 770
RVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRIT    771 - 840
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVG    841 - 910
PPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQL    911 - 980
KDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRL    981 - 1050
ESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMH   1051 - 1120
VDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHD   1121 - 1190
GKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS          1191 - 1253
//

Text Mined References (39)

PMID Year Title
26843638 2016 Cyfip1 Regulates Presynaptic Activity during Development.
26824476 2016 Reduced CYFIP1 in Human Neural Progenitors Results in Dysregulation of Schizophrenia and Epilepsy Gene Networks.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25311365 2015 Increased CYFIP1 dosage alters cellular and dendritic morphology and dysregulates mTOR.
25048004 2015 Proteomic and genomic evidence implicates the postsynaptic density in schizophrenia.
24996170 2014 Modeling a genetic risk for schizophrenia in iPSCs and mice reveals neural stem cell deficits associated with adherens junctions and polarity.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24442360 2014 Common variants in genes of the postsynaptic FMRP signalling pathway are risk factors for autism spectrum disorders.
24439377 2014 Local F-actin network links synapse formation and axon branching.
More...