Property Summary

NCBI Gene PubMed Count 45
PubMed Score 28.53
PubTator Score 20.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.372 2.2e-05
astrocytoma 1.500 1.3e-02
autosomal dominant Emery-Dreifuss muscul... 1.069 9.3e-03
Chronic Lymphocytic Leukemia 1.088 1.1e-02
dermatomyositis 1.200 5.8e-03
Duchenne muscular dystrophy 1.305 2.3e-07
glioblastoma 1.400 2.4e-03
juvenile dermatomyositis 1.366 7.1e-13
Multiple myeloma 1.200 1.5e-03
ovarian cancer -2.100 4.7e-07
psoriasis 1.100 2.0e-04
sonic hedgehog group medulloblastoma 1.100 3.0e-03
tuberculosis 1.200 3.3e-05
Waldenstrons macroglobulinemia 1.348 1.9e-02

Gene RIF (16)

AA Sequence

MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMN      1 - 70
EMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEV     71 - 140
RRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNL    141 - 210
SMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSN    211 - 280
IYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMI    281 - 350
QIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT    351 - 420
DKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQV    421 - 490
TLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLY    491 - 560
MVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLEL    561 - 630
TMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFD    631 - 700
QFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQ    701 - 770
RVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRIT    771 - 840
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVG    841 - 910
PPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQL    911 - 980
KDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRL    981 - 1050
ESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMH   1051 - 1120
VDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHD   1121 - 1190
GKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS          1191 - 1253
//

Text Mined References (50)

PMID Year Title