Property Summary

NCBI Gene PubMed Count 21
PubMed Score 36.01
PubTator Score 17.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 4.3458256044472E-6
medulloblastoma, large-cell 6234 6.58033988080163E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0115037145873058
Disease Target Count Z-score Confidence
Peanut allergy 5 3.99 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.001
pancreatic ductal adenocarcinoma liver m... -1.237 0.012
ovarian cancer -1.700 0.000

Synonym

Accession Q7L523 B2R7L1 O00290 Q15347 Rag A
Symbols FIP1
RAGA
FIP-1

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (4)

PMID Text
26227614 Data suggest that both microtubule-associated DYNLT (dynein light chain Tctex-type 1) and cytoplasmic DYNLT (dynein 1 intermediate chain 2 DYNC1LI2) are equally able to bind to small GTPases Rab3D (Rab3d GTPase) and RagA (Ras-related GTP binding A).
26051179 Data suugest that S-phase kinase-associated protein 2 (Skp2)-mediated Ras-related GTP-binding protein RagA ubiquitination recruits GATOR1 to restrict mTORC1 signaling upon sustained amino acid stimulation.
25936802 A mechanism for regulation of mTORC1 signaling by RNF152-mediated K63-linked polyubiquitination of RagA.
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related GTP binding protein A (RRAGA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFM      1 - 70
ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLI     71 - 140
FKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERAT    141 - 210
FLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPS    211 - 280
IPSAATLINIRNARKHFEKLERVDGPKHSLLMR                                         281 - 313
//

Text Mined References (25)

PMID Year Title
26227614 2015 DYNLT (Tctex-1) forms a tripartite complex with dynein intermediate chain and RagA, hence linking this small GTPase to the dynein motor.
26051179 2015 Skp2-Mediated RagA Ubiquitination Elicits a Negative Feedback to Prevent Amino-Acid-Dependent mTORC1 Hyperactivation by Recruiting GATOR1.
25936802 2015 The ubiquitination of rag A GTPase by RNF152 negatively regulates mTORC1 activation.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
22575674 2012 SH3BP4 is a negative regulator of amino acid-Rag GTPase-mTORC1 signaling.
More...