Property Summary

NCBI Gene PubMed Count 21
Grant Count 33
R01 Count 24
Funding $5,986,821.71
PubMed Score 36.01
PubTator Score 17.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.001
pancreatic ductal adenocarcinoma liver m... -1.237 0.012
ovarian cancer -1.700 0.000

Gene RIF (7)

PMID Text
26227614 Data suggest that both microtubule-associated DYNLT (dynein light chain Tctex-type 1) and cytoplasmic DYNLT (dynein 1 intermediate chain 2 DYNC1LI2) are equally able to bind to small GTPases Rab3D (Rab3d GTPase) and RagA (Ras-related GTP binding A).
26051179 Data suugest that S-phase kinase-associated protein 2 (Skp2)-mediated Ras-related GTP-binding protein RagA ubiquitination recruits GATOR1 to restrict mTORC1 signaling upon sustained amino acid stimulation.
25936802 A mechanism for regulation of mTORC1 signaling by RNF152-mediated K63-linked polyubiquitination of RagA.
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related GTP binding protein A (RRAGA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related GTP binding protein A (RRAGA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related GTP binding protein A (RRAGA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ras-related GTP binding protein A (RRAGA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFM      1 - 70
ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLI     71 - 140
FKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERAT    141 - 210
FLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPS    211 - 280
IPSAATLINIRNARKHFEKLERVDGPKHSLLMR                                         281 - 313
//

Text Mined References (25)

PMID Year Title
26227614 2015 DYNLT (Tctex-1) forms a tripartite complex with dynein intermediate chain and RagA, hence linking this small GTPase to the dynein motor.
26051179 2015 Skp2-Mediated RagA Ubiquitination Elicits a Negative Feedback to Prevent Amino-Acid-Dependent mTORC1 Hyperactivation by Recruiting GATOR1.
25936802 2015 The ubiquitination of rag A GTPase by RNF152 negatively regulates mTORC1 activation.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
22575674 2012 SH3BP4 is a negative regulator of amino acid-Rag GTPase-mTORC1 signaling.
More...