Property Summary

NCBI Gene PubMed Count 26
PubMed Score 40.55
PubTator Score 17.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 6.6e-04
ovarian cancer -1.700 4.3e-06
pancreatic ductal adenocarcinoma liver m... -1.237 1.2e-02

Protein-protein Interaction (6)

Gene RIF (8)

AA Sequence

MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFM      1 - 70
ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLI     71 - 140
FKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERAT    141 - 210
FLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPS    211 - 280
IPSAATLINIRNARKHFEKLERVDGPKHSLLMR                                         281 - 313
//

Text Mined References (29)

PMID Year Title