Property Summary

NCBI Gene PubMed Count 18
Grant Count 23
R01 Count 1
Funding $7,107,201.25
PubMed Score 34.33
PubTator Score 30.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -3.686 0.000
periodontitis 1.900 0.000
medulloblastoma, large-cell 1.600 0.000
tuberculosis and treatment for 3 months 1.900 0.009
interstitial cystitis 2.400 0.007
adult high grade glioma 1.700 0.001
group 3 medulloblastoma -1.100 0.040
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 2.400 0.000
nasopharyngeal carcinoma -1.200 0.000
ulcerative colitis 1.400 0.039
ovarian cancer 1.400 0.000

Gene RIF (7)

PMID Text
27015273 FCGR2C SNPs that associated with vaccine efficacy in RV144 also strongly associated with the expression of FCGR2A/C and one of them also associated with the expression of Fc receptor-like A (FCRLA), another Fc-gamma receptor (FcgammaR) gene
23742757 alternative splicing of FCRLA mRNA results in the production of isoforms differing by their domain composition and possessing either the short or long signal peptide.
21149418 The studies reported here demonstrate that FCRLA is more broadly expressed among human B lineage cells than originally reported; it is found at significant levels in resting blood B cells and at varying levels in all B-cell subsets in tonsil.
20668221 Analysis of human cell lines has confirmed that FcRLA is not secreted but is maintained as an intracellular protein in B cells where it interacts with immunoglobulins.
20237496 Observational study of gene-disease association. (HuGE Navigator)
15551350 FCRL/FREB may function in melanocytes and melanoma and may be useful for development of diagnostic methods for various pigment disorders and immunotherapy of melanoma.
12966588 The concentration of FREB FCRL in patients with rheumatoid arthritis is three times higher than in healthy adults.

AA Sequence

MKLGCVLMAWALYLSLGVLWVAQMLLAASFETLQCEGPVCTEESSCHTEDDLTDAREAGFQVKAYTFSEP      1 - 70
FHLIVSYDWLILQGPAKPVFEGDLLVLRCQAWQDWPLTQVTFYRDGSALGPPGPNREFSITVVQKADSGH     71 - 140
YHCSGIFQSPGPGIPETASVVAITVQELFPAPILRAVPSAEPQAGSPMTLSCQTKLPLQRSAARLLFSFY    141 - 210
KDGRIVQSRGLSSEFQIPTASEDHSGSYWCEAATEDNQVWKQSPQLEIRVQGASSSAAPPTLNPAPQKSA    211 - 280
APGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRK    281 - 350
PGTTKATAE                                                                 351 - 359
//

Text Mined References (19)

PMID Year Title
27015273 2016 FCGR2C Polymorphisms Associated with HIV-1 Vaccine Protection Are Linked to Altered Gene Expression of Fc-? Receptors in Human B Cells.
23742757 2013 Characterization of human FCRLA isoforms.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21269460 2011 Initial characterization of the human central proteome.
21149418 2011 FCRLA is a resident endoplasmic reticulum protein that associates with intracellular Igs, IgM, IgG and IgA.
20668221 2010 Fc receptor-like A associates with intracellular IgG and IgM but is dispensable for antigen-specific immune responses.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15815692 2005 A new Fc receptor homolog, FREB2, found in germinal center B cells.
More...