Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.53
PubTator Score 3.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 4.5e-03
colon cancer -1.300 2.5e-03
ependymoma -1.400 2.9e-02
group 3 medulloblastoma 1.700 1.3e-02
head and neck cancer -1.300 1.7e-02
intraductal papillary-mucinous neoplasm ... -1.100 7.7e-03
invasive ductal carcinoma -1.400 5.3e-03
medulloblastoma, large-cell -1.200 4.1e-03
oligodendroglioma -1.200 1.7e-02
pituitary cancer 1.800 6.8e-07

AA Sequence

MYAFVRFLEDNVCYALPVSCVRDFSPRSRLDFDNQKVYAVYRGPEELGAGPESPPRAPRDWGALLLHKAQ      1 - 70
ILALAEDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIKRPEGRKPSEVAHKSIEAVVA     71 - 140
RLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPRALYEELLRNYQQQQEEMRHLQQELERTRRQ    141 - 210
LVQQAKKLKEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSS    211 - 280
YYPAPAPVMDKYILDNGKVHLGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKK    281 - 350
KKDAVPKPPLSPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNL    351 - 420
Q//

Text Mined References (12)

PMID Year Title