Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.34
PubTator Score 3.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pituitary cancer 1972 6.75410365053024E-7
colon cancer 1475 0.00250964680827653
medulloblastoma, large-cell 6234 0.00410085262165951
atypical teratoid / rhabdoid tumor 4369 0.00453592120299572
invasive ductal carcinoma 2950 0.0053396186320694
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00773827927255677
group 3 medulloblastoma 2254 0.0134377082023478
head and neck cancer 270 0.0166951143181207
oligodendroglioma 2849 0.0169951934356801
ependymoma 2514 0.0291822172717441
Disease Target Count Z-score Confidence
Ganglioglioma 16 3.324 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.400 0.029
oligodendroglioma -1.200 0.017
atypical teratoid / rhabdoid tumor -1.400 0.005
medulloblastoma, large-cell -1.200 0.004
intraductal papillary-mucinous neoplasm ... -1.100 0.008
colon cancer -1.300 0.003
group 3 medulloblastoma 1.700 0.013
invasive ductal carcinoma -1.400 0.005
pituitary cancer 1.800 0.000
head and neck cancer -1.300 0.017

Synonym

Accession Q7L4P6 D3DQ27 Q96A62 Q9HAI3
Symbols C1orf165

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MYAFVRFLEDNVCYALPVSCVRDFSPRSRLDFDNQKVYAVYRGPEELGAGPESPPRAPRDWGALLLHKAQ      1 - 70
ILALAEDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIKRPEGRKPSEVAHKSIEAVVA     71 - 140
RLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPRALYEELLRNYQQQQEEMRHLQQELERTRRQ    141 - 210
LVQQAKKLKEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSS    211 - 280
YYPAPAPVMDKYILDNGKVHLGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKK    281 - 350
KKDAVPKPPLSPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNL    351 - 420
Q//

Text Mined References (10)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
23468431 2013 The BEN domain is a novel sequence-specific DNA-binding domain conserved in neural transcriptional repressors.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.