Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.80
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.7e-07
ovarian cancer 8520 7.4e-07
intraductal papillary-mucinous adenoma (IPMA) 2955 2.0e-03
Multiple myeloma 1332 9.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 2.0e-03
Multiple myeloma 1.202 9.3e-03
osteosarcoma 1.816 5.7e-07
ovarian cancer -1.500 7.4e-07

Gene RIF (1)

AA Sequence

MAASDTERDGLAPEKTSPDRDKKKEQSEVSVSPRASKHHYSRSRSRSRERKRKSDNEGRKHRSRSRSKEG      1 - 70
RRHESKDKSSKKHKSEEHNDKEHSSDKGRERLNSSENGEDRHKRKERKSSRGRSHSRSRSRERRHRSRSR     71 - 140
ERKKSRSRSRERKKSRSRSRERKKSRSRSRERKRRIRSRSRSRSRHRHRTRSRSRTRSRSRDRKKRIEKP    141 - 210
RRFSRSLSRTPSPPPFRGRNTAMDAQEALARRLERAKKLQEQREKEMVEKQKQQEIAAAAATGGSVLNVA    211 - 280
ALLASGTQVTPQIAMAAQMAALQAKALAETGIAVPSYYNPAAVNPMKFAEQEKKRKMLWQGKKEGDKSQS    281 - 350
AEIWEKLNFGNKDQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARSQTHTQRGM    351 - 420
GLGFTSSMRGMDAV                                                            421 - 434
//

Text Mined References (18)

PMID Year Title