Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 1.8e-07
medulloblastoma, large-cell 6241 3.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.8e-07
medulloblastoma, large-cell -1.500 3.9e-05

Protein-protein Interaction (7)

Gene RIF (1)

AA Sequence

MAFRRAEGTSMIQALAMTVAEIPVFLYTTFGQSAFSQLRLTPGLRKVLFATALGTVALALAAHQLKRRRR      1 - 70
RKKQVGPEMGGEQLGTVPLPILLARKVPSVKKGYSSRRVQSPSSKSNDTLSGISSIEPSKHSGSSHSVAS     71 - 140
MMAVNSSSPTAACSGLWDARGMEESLTTSDGNAESLYMQGMELFEEALQKWEQALSVGQRGDSGSTPMPR    141 - 210
DGLRNPETASEPLSEPESQRKEFAEKLESLLHRAYHLQEEFGSTFPADSMLLDLERTLMLPLTEGSLRLR    211 - 280
ADDEDSLTSEDSFFSATELFESLQTGDYPIPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFL    281 - 350
AKLHCVRQAFEGLLEDKSNQLFFGKVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELE    351 - 420
GRGVVCMSFFDIVLDFILMDAFEDLENPPASVLAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDG    421 - 490
FISHFYSVSEHVSPVLAFGFLGPKPQLAEVCAFFKHQIVQYLRDMFDLDNVRYTSLPALADDILQLSRRR    491 - 560
SEILLGYLGVPAASSAGVNGALPRENGPLGELQ                                         561 - 593
//

Text Mined References (12)

PMID Year Title