Property Summary

NCBI Gene PubMed Count 7
PubMed Score 130.88
PubTator Score 9.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.300 3.5e-02
glioblastoma -1.200 1.9e-05
lung cancer 1.300 3.6e-03
malignant mesothelioma 1.900 9.8e-07
osteosarcoma -1.462 4.6e-06

Gene RIF (3)

AA Sequence

MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASG      1 - 70
TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVC     71 - 140
EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLP    141 - 210
VVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSS    211 - 280
KPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVE    281 - 350
APETPGEPPLSPGF                                                            351 - 364
//

Text Mined References (11)

PMID Year Title