Property Summary

NCBI Gene PubMed Count 7
Grant Count 127
R01 Count 87
Funding $9,695,632.67
PubMed Score 123.09
PubTator Score 9.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
osteosarcoma -1.462 0.000
glioblastoma -1.200 0.000
colon cancer 1.300 0.035
lung cancer 1.300 0.004

Synonym

Accession Q7L3V2 A8K5E7 D3DX21 Q6MZM8 Q6N000 Q9H7A0
Symbols BOP

Gene

Gene RIF (3)

PMID Text
25404273 Studies indicate that BH3-only protein (C22orf29 protein) plays an important role in activation and communication in apoptosis pathways.
24673301 Members of the subfamily of BH3-only proteins function as proapoptotic triggers, and mimetics of these proteins are already in clinical trials in other cancers.
23055042 Bop may be a novel BH3-only factor that can engage with the regulatory network of Bcl-2 family members to process intrinsic apoptotic signaling

AA Sequence

MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASG      1 - 70
TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVC     71 - 140
EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLP    141 - 210
VVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSS    211 - 280
KPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVE    281 - 350
APETPGEPPLSPGF                                                            351 - 364
//

Text Mined References (11)

PMID Year Title
25404273 2014 [Effect and significance of BH3-only protein in targeted therapy of? non-small cell lung cancer].
24673301 2014 BH3-only proteins: possible proapoptotic triggers for melanoma therapy.
23055042 2012 Human Bop is a novel BH3-only member of the Bcl-2 protein family.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
More...