Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.622 0.000
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.300 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.100 0.001
adult high grade glioma -1.500 0.000
ovarian cancer -1.100 0.001

AA Sequence

MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGR      1 - 70
AFARRSTLAKHARTHTGERPFGCTECGRRFSQKSALTKHGRTHTGERPYECPECDKRFSAASNLRQHRRR     71 - 140
HTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDCGRAFGGSSCLARHRRTHTGERPYACADCGT    141 - 210
RFAQSSALAKHRRVHTGEKPHRCAVCGRRFGHRSNLAEHARTHTGERPYPCAECGRRFRLSSHFIRHRRA    211 - 280
HMRRRLYICAGCGRDFKLPPGATAATATERCPECEGS                                     281 - 317
//

Text Mined References (4)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.