Property Summary

NCBI Gene PubMed Count 9
Grant Count 93
Funding $45,094,112.41
PubMed Score 10.51
PubTator Score 5.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
astrocytic glioma -1.600 0.039
ependymoma -1.100 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -2.000 0.000
pancreatic ductal adenocarcinoma liver m... -2.092 0.001
tuberculosis -1.500 0.000
adult high grade glioma -1.500 0.001
aldosterone-producing adenoma -1.068 0.034
psoriasis -1.100 0.000
spina bifida -1.501 0.038
ovarian cancer -1.600 0.000

Synonym

Accession Q7L3B6 B1AL70 Q9NWS3 Q9NX16
Symbols HARC
CDC37B

Gene

Gene RIF (2)

PMID Text
18052042 C-terminal domain of Harc is a key determinant of its cochaperone functions
15850399 Harc forms dimers in vitro. The structural similarities between Harc and Cdc37 suggest that Harc may function to regulate the Hsp90-mediated folding of Cdc37-dependent protein kinases into functional conformations via dimerization with Cdc37.

AA Sequence

MEQPWPPPGPWSLPRAEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSVACKWN      1 - 70
LAEAQQKLGSLALHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSF     71 - 140
INQDKRKDTEDEDKSESFMQKYEQKIRHFGMLSRWDDSQRFLSDHPYLVCEETAKYLILWCFHLEAEKKG    141 - 210
ALMEQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNELEAFKSRVRLYSQSQSFQ    211 - 280
PMTVQNHVPHSGVGSIGLLESLPQNPDYLQYSISTALCSLNSVVHKEDDEPKMMDTV                 281 - 337
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18052042 2007 Importance of the C-terminal domain of Harc for binding to Hsp70 and Hop as well as its response to heat shock.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...