Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.51
PubTator Score 5.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 1.3e-03
aldosterone-producing adenoma -1.068 3.4e-02
astrocytic glioma -1.600 3.9e-02
atypical teratoid / rhabdoid tumor -1.500 1.4e-06
ependymoma -1.100 3.9e-06
glioblastoma -1.100 7.2e-04
hepatocellular carcinoma 1.200 2.0e-04
medulloblastoma, large-cell -2.000 6.8e-05
ovarian cancer -1.100 3.3e-04
pancreatic ductal adenocarcinoma liver m... -2.092 7.2e-04
psoriasis -1.100 1.6e-09
spina bifida -1.501 3.8e-02
tuberculosis -1.500 1.3e-05

Synonym

Accession Q7L3B6 B1AL70 Q9NWS3 Q9NX16
Symbols HARC
CDC37B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MEQPWPPPGPWSLPRAEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSVACKWN      1 - 70
LAEAQQKLGSLALHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSF     71 - 140
INQDKRKDTEDEDKSESFMQKYEQKIRHFGMLSRWDDSQRFLSDHPYLVCEETAKYLILWCFHLEAEKKG    141 - 210
ALMEQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNELEAFKSRVRLYSQSQSFQ    211 - 280
PMTVQNHVPHSGVGSIGLLESLPQNPDYLQYSISTALCSLNSVVHKEDDEPKMMDTV                 281 - 337
//

Text Mined References (17)

PMID Year Title