Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.02
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 2.216 1.2e-03
intraductal papillary-mucinous carcinoma... -1.200 2.4e-02
malignant mesothelioma -2.000 8.5e-08
medulloblastoma, large-cell -1.200 2.1e-03
oligodendroglioma -1.200 4.7e-02
osteosarcoma 1.354 5.3e-03
ovarian cancer -2.200 5.7e-07
psoriasis -1.100 4.0e-06
ulcerative colitis 1.500 4.1e-06

Gene RIF (1)

AA Sequence

MSRVRDAGCVAAGIVIGAGAWYCVYKYTRGRDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFS      1 - 70
PPTPVRAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIA     71 - 140
PPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRAAVPPGTVVPTEAAAPTEVTEGPGVAAPTKVAEAPG    141 - 210
VASPTEAAEAPVPATPTGAAAPTGAAESPGTSGSPRTAVVPGTSAAKKATPGAHTGAIPKATSATGAVPK    211 - 280
GGGKGVTRSRNGGKGKGKKSKVEVDELGMGFRPGDGAAAAAAASANGGQAFLAEVPDSEEGESGWTDTES    281 - 350
DSDSEPETQRRGRGRRPVAMQKRPFPYEIDEILGVRDLRKVLALLQKSDDPFIQQVALLTLSNNANYSCN    351 - 420
QETIRKLGGLPIIANMINKTDPHIKEKALMAMNNLSENYENQGRLQVYMNKVMDDIMASNLNSAVQVVGL    421 - 490
KFLTNMTITNDYQHLLVNSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPASFSSLYNS    491 - 560
YVESEILINALTLFEIIYDNLRAEVFNYREFNKGSLFYLCTTSGVCVKKIRALANHHDLLVKVKVIKLVN    561 - 630
KF                                                                        631 - 632
//

Text Mined References (11)

PMID Year Title